(data stored in ACNUC7421 zone)

EMBL: CP001053.PE499

CP001053.PE499       Location/Qualifiers
FT   CDS             complement(570962..571450)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4501"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0821 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4501"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18874"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY8"
FT                   /protein_id="ACD18874.1"
FT                   /translation="MHFVGNGSNGDQPLDFSNSVGLAGSWNGGGKTLPVSFNLEGMSFA
FT                   DANTGHRYGMITNETDDAFEARAQGFYFAALKGDPKQAARFVHFPLRVNWSATHHEMID
FT                   SASQLAANWNRIFTPKYLAALRDVVPHDMPVIKSQYAMLGAGLAFFTDKGVEVLNAQR"
     MHFVGNGSNG DQPLDFSNSV GLAGSWNGGG KTLPVSFNLE GMSFADANTG HRYGMITNET        60
     DDAFEARAQG FYFAALKGDP KQAARFVHFP LRVNWSATHH EMIDSASQLA ANWNRIFTPK       120
     YLAALRDVVP HDMPVIKSQY AMLGAGLAFF TDKGVEVLNA QR                          162
//

If you have problems or comments...

PBIL Back to PBIL home page