(data stored in ACNUC7421 zone)

EMBL: CP001053.PE504

CP001053.PE504       Location/Qualifiers
FT   CDS             complement(575487..576452)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4506"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0824 putative lipase (esterase)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4506"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18879"
FT                   /db_xref="GOA:B2TDY2"
FT                   /db_xref="InterPro:IPR002168"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY2"
FT                   /protein_id="ACD18879.1"
FT                   /translation="MLEPEMAAFIERAAAIYRGHSTSLTPPEQRKIYDQYAAAVTPALP
FT                   DDVVTHDAEFHTGAGHSIALRLYRNHARHHDAARGAVLYFHGGGFVLGSLDSHQLVTAR
FT                   LAADTDLDVIAVDYRLAPEHPAPAAHDDCMEVTLAALAGRLPFELHAGAPLQLAGDSAG
FT                   ATLAASVAMRLRDDAVQGISGLVLVYPMLGTDPQLPARDSEALAPMLKLTDVHAFRDLY
FT                   WGPHPPYPAWTIPLDATRYDGLPPTLAIGVEHDPLRDDARVFAERINAAGGEARLMIGA
FT                   GLVHGCWRAIESSPGVQRLHEEVCRFLSAHATPGSSADNR"
     MLEPEMAAFI ERAAAIYRGH STSLTPPEQR KIYDQYAAAV TPALPDDVVT HDAEFHTGAG        60
     HSIALRLYRN HARHHDAARG AVLYFHGGGF VLGSLDSHQL VTARLAADTD LDVIAVDYRL       120
     APEHPAPAAH DDCMEVTLAA LAGRLPFELH AGAPLQLAGD SAGATLAASV AMRLRDDAVQ       180
     GISGLVLVYP MLGTDPQLPA RDSEALAPML KLTDVHAFRD LYWGPHPPYP AWTIPLDATR       240
     YDGLPPTLAI GVEHDPLRDD ARVFAERINA AGGEARLMIG AGLVHGCWRA IESSPGVQRL       300
     HEEVCRFLSA HATPGSSADN R                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page