(data stored in ACNUC7421 zone)

EMBL: CP001053.PE506

CP001053.PE506       Location/Qualifiers
FT   CDS             complement(577184..578149)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4508"
FT                   /product="3-hydroxyacyl-CoA dehydrogenase NAD-binding"
FT                   /note="PFAM: 3-hydroxyacyl-CoA dehydrogenase domain
FT                   protein; 3-hydroxyacyl-CoA dehydrogenase NAD-binding; KEGG:
FT                   bxe:Bxe_B0826 3-hydroxybutyryl-CoA dehydrogenase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4508"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18881"
FT                   /db_xref="GOA:B2TDY4"
FT                   /db_xref="InterPro:IPR006108"
FT                   /db_xref="InterPro:IPR006176"
FT                   /db_xref="InterPro:IPR008927"
FT                   /db_xref="InterPro:IPR013328"
FT                   /db_xref="InterPro:IPR026578"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDY4"
FT                   /protein_id="ACD18881.1"
FT                   /translation="MAVIVDIKTFAAIGVGVIGSGWVARALAHGLDVIAWDPAPGAEKQ
FT                   LRENVANAWSALQRVGLAAGASPERLRFVDTIQACVGQADFIQESAPEREELKLSLHEQ
FT                   ISRAAKPDAIIASSTSGLLPSDFYARAVNPQRCIVGHPFNPVYLLPLVEVLGGESTAPE
FT                   TIDAALQVYRALSMRPLRVRKEVPGFIADRLLEALWREALHLVNEGVATTGEIDDAIRF
FT                   GAGIRWSFMGTFLTYTLAGGDAGMRHFMQQFGPALELPWTKLVAPKLTDELIDRVVDGT
FT                   AEQVGPRSIKQLERYRDDCITSVLTAIAEAKARHGMQPAE"
     MAVIVDIKTF AAIGVGVIGS GWVARALAHG LDVIAWDPAP GAEKQLRENV ANAWSALQRV        60
     GLAAGASPER LRFVDTIQAC VGQADFIQES APEREELKLS LHEQISRAAK PDAIIASSTS       120
     GLLPSDFYAR AVNPQRCIVG HPFNPVYLLP LVEVLGGEST APETIDAALQ VYRALSMRPL       180
     RVRKEVPGFI ADRLLEALWR EALHLVNEGV ATTGEIDDAI RFGAGIRWSF MGTFLTYTLA       240
     GGDAGMRHFM QQFGPALELP WTKLVAPKLT DELIDRVVDG TAEQVGPRSI KQLERYRDDC       300
     ITSVLTAIAE AKARHGMQPA E                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page