(data stored in ACNUC7421 zone)

EMBL: CP001053.PE507

CP001053.PE507       Location/Qualifiers
FT   CDS             complement(578213..579142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4509"
FT                   /product="protein of unknown function DUF849"
FT                   /note="PFAM: protein of unknown function DUF849; KEGG:
FT                   bxe:Bxe_B0827 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4509"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18882"
FT                   /db_xref="GOA:B2TGS1"
FT                   /db_xref="InterPro:IPR008567"
FT                   /db_xref="InterPro:IPR013785"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS1"
FT                   /protein_id="ACD18882.1"
FT                   /translation="MNHEVIVTCAVTGAGDTVGKHPAIPVTPKQIAEAAIEAAKAGATV
FT                   AHCHVRDPKTGRGSRDPQLYREVVDRIRSSGTDVIINLTAGMGGDLEIGPGEDPMRFGA
FT                   NTDLVGGLTRLAHVEELLPEICTLDCGTLNFGDGDYIYVSTPAQLRAGARRIQELGVKP
FT                   ELEIFDTGHLWFAKQLLKEGLLDAPPLFQICLGIPWGAPADTTTMKAMADNLPPGAQWA
FT                   GFGIGRMQMPMVAQAMLLGGHVRVGLEDNIWLDKGVPATNGTLVQRAVEIIERLGARAL
FT                   TPAEGRRKLGLPARGERQLERREAGQYA"
     MNHEVIVTCA VTGAGDTVGK HPAIPVTPKQ IAEAAIEAAK AGATVAHCHV RDPKTGRGSR        60
     DPQLYREVVD RIRSSGTDVI INLTAGMGGD LEIGPGEDPM RFGANTDLVG GLTRLAHVEE       120
     LLPEICTLDC GTLNFGDGDY IYVSTPAQLR AGARRIQELG VKPELEIFDT GHLWFAKQLL       180
     KEGLLDAPPL FQICLGIPWG APADTTTMKA MADNLPPGAQ WAGFGIGRMQ MPMVAQAMLL       240
     GGHVRVGLED NIWLDKGVPA TNGTLVQRAV EIIERLGARA LTPAEGRRKL GLPARGERQL       300
     ERREAGQYA                                                               309
//

If you have problems or comments...

PBIL Back to PBIL home page