(data stored in ACNUC7421 zone)

EMBL: CP001053.PE509

CP001053.PE509       Location/Qualifiers
FT   CDS             580497..581522
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4511"
FT                   /product="transcriptional regulator, AraC family"
FT                   /note="PFAM: helix-turn-helix- domain containing protein
FT                   AraC type; ThiJ/PfpI domain protein; KEGG: bxe:Bxe_B0829
FT                   transcriptional regulator, AraC family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4511"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18884"
FT                   /db_xref="GOA:B2TGS3"
FT                   /db_xref="InterPro:IPR002818"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR018062"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS3"
FT                   /protein_id="ACD18884.1"
FT                   /translation="MPEDMSFLLLPGFSAIGFMSAVEPLRVANRYRGDLYRWRILSLDG
FT                   APVAASNGISINADAAIGDVEAARTLFVVAGFEPLACYTRELGDCLKRLARAGATLGGI
FT                   DTGSFVLAEAGLLGGSDSVTVHWEALSAFRERYPSLDASQELFEIGARRITCAGGTASI
FT                   DMMLDLIGREHGAALASAVSEQFVVSRIRRRSDHQRMEVAARYGVHNRKLIQVIGVMEQ
FT                   HMEEPLTPDRLAQEIGVTRRQLERLFCASLKDTPTHFYQQLRLARARELLQQTDMSITS
FT                   ICVACGFESPSHFSRTYRARFGASPRSDRQGTGGRNAGELERSAGQDLVSAPQLSRLSQ
FT                   Q"
     MPEDMSFLLL PGFSAIGFMS AVEPLRVANR YRGDLYRWRI LSLDGAPVAA SNGISINADA        60
     AIGDVEAART LFVVAGFEPL ACYTRELGDC LKRLARAGAT LGGIDTGSFV LAEAGLLGGS       120
     DSVTVHWEAL SAFRERYPSL DASQELFEIG ARRITCAGGT ASIDMMLDLI GREHGAALAS       180
     AVSEQFVVSR IRRRSDHQRM EVAARYGVHN RKLIQVIGVM EQHMEEPLTP DRLAQEIGVT       240
     RRQLERLFCA SLKDTPTHFY QQLRLARARE LLQQTDMSIT SICVACGFES PSHFSRTYRA       300
     RFGASPRSDR QGTGGRNAGE LERSAGQDLV SAPQLSRLSQ Q                           341
//

If you have problems or comments...

PBIL Back to PBIL home page