(data stored in ACNUC7421 zone)

EMBL: CP001053.PE51

CP001053.PE51        Location/Qualifiers
FT   CDS             55894..56592
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4040"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bmu:Bmul_0032 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4040"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18426"
FT                   /db_xref="GOA:B2TEA5"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA5"
FT                   /protein_id="ACD18426.1"
FT                   /translation="MKLLLVEDDADLARWVMNLMQVEHFVIDWAQNGEQAETLLGLQCY
FT                   DAVLLDLRLPGIGGKDVLARLRRKRDNVPVLMLTANGSTDDKVACFSAGADDYVVKPFD
FT                   ARELVARIKALIRRQAAGDKGQSIECGDLRYLFDSREFMLQSEPLPLRRREHAILETLM
FT                   LKQGKTVSKSTLMDKVFTLDDEPSADAIDIYIHRLRKHLAASSAKIMTLRGLGYILREA
FT                   EPREAFAAAL"
     MKLLLVEDDA DLARWVMNLM QVEHFVIDWA QNGEQAETLL GLQCYDAVLL DLRLPGIGGK        60
     DVLARLRRKR DNVPVLMLTA NGSTDDKVAC FSAGADDYVV KPFDARELVA RIKALIRRQA       120
     AGDKGQSIEC GDLRYLFDSR EFMLQSEPLP LRRREHAILE TLMLKQGKTV SKSTLMDKVF       180
     TLDDEPSADA IDIYIHRLRK HLAASSAKIM TLRGLGYILR EAEPREAFAA AL               232
//

If you have problems or comments...

PBIL Back to PBIL home page