(data stored in ACNUC7421 zone)

EMBL: CP001053.PE510

CP001053.PE510       Location/Qualifiers
FT   CDS             581632..581958
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4512"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0830 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4512"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18885"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS4"
FT                   /protein_id="ACD18885.1"
FT                   /translation="MKSLIEAVVIAALISAPLAAFAQSNQPVTRAQVRAELIQLEKAGY
FT                   NPGTANDEDYPSNIQAAEARVAAQKSAAQTSGYGSATNGSSQAGTRSDTTNSSYSAPVV
FT                   TYGR"
     MKSLIEAVVI AALISAPLAA FAQSNQPVTR AQVRAELIQL EKAGYNPGTA NDEDYPSNIQ        60
     AAEARVAAQK SAAQTSGYGS ATNGSSQAGT RSDTTNSSYS APVVTYGR                    108
//

If you have problems or comments...

PBIL Back to PBIL home page