(data stored in ACNUC7421 zone)

EMBL: CP001053.PE512

CP001053.PE512       Location/Qualifiers
FT   CDS             complement(582488..582913)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4514"
FT                   /product="conserved hypothetical protein"
FT                   /note="PFAM: conserved hypothetical protein; KEGG:
FT                   bvi:Bcep1808_6067 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4514"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18887"
FT                   /db_xref="InterPro:IPR008318"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGS6"
FT                   /protein_id="ACD18887.1"
FT                   /translation="MNASTRIRLITLAEHASDASNPSRQVVSLANDADPAEQKELIATA
FT                   ARVELHFPNFTDGRAYSQAYLLRRRLGFKGDLRATGDVLVDQLIQMERTGFSSAVLKDG
FT                   IDPEDAQRQLDRFPAFYQGDVIHDAPFVRSDVGSNDE"
     MNASTRIRLI TLAEHASDAS NPSRQVVSLA NDADPAEQKE LIATAARVEL HFPNFTDGRA        60
     YSQAYLLRRR LGFKGDLRAT GDVLVDQLIQ MERTGFSSAV LKDGIDPEDA QRQLDRFPAF       120
     YQGDVIHDAP FVRSDVGSND E                                                 141
//

If you have problems or comments...

PBIL Back to PBIL home page