(data stored in ACNUC7421 zone)

EMBL: CP001053.PE519

CP001053.PE519       Location/Qualifiers
FT   CDS             complement(591281..592117)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4521"
FT                   /product="protein of unknown function DUF6 transmembrane"
FT                   /note="PFAM: protein of unknown function DUF6
FT                   transmembrane; KEGG: bxe:Bxe_B0836 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4521"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18894"
FT                   /db_xref="GOA:B2TGT3"
FT                   /db_xref="InterPro:IPR000620"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT3"
FT                   /protein_id="ACD18894.1"
FT                   /translation="METLVVLLVLLSALLHATWNAFLHLSEDRIWLLGMMAMPYIAVSA
FT                   VGVIVLPMPAPAAWPYIFASVVLEFGYLLALIRAYKSGDFGQIYPIARGLSPMLVFVGA
FT                   LVFAHEALKPLAAIGVALVSLGIVSLAFRRGMRFSGESVPFALLTGFFIATYSVVDGIG
FT                   ARLAGNGLSYIMWVYLIWNIPQFLLAWHWRGGAKGLFIGRAMVLKGIAAGLLALSAYCL
FT                   IIEAYRYLPIAMVSALREMSSIFAVLIGWLFMREKLTARRIVACALVTLGAVLIRV"
     METLVVLLVL LSALLHATWN AFLHLSEDRI WLLGMMAMPY IAVSAVGVIV LPMPAPAAWP        60
     YIFASVVLEF GYLLALIRAY KSGDFGQIYP IARGLSPMLV FVGALVFAHE ALKPLAAIGV       120
     ALVSLGIVSL AFRRGMRFSG ESVPFALLTG FFIATYSVVD GIGARLAGNG LSYIMWVYLI       180
     WNIPQFLLAW HWRGGAKGLF IGRAMVLKGI AAGLLALSAY CLIIEAYRYL PIAMVSALRE       240
     MSSIFAVLIG WLFMREKLTA RRIVACALVT LGAVLIRV                               278
//

If you have problems or comments...

PBIL Back to PBIL home page