(data stored in ACNUC7421 zone)

EMBL: CP001053.PE523

CP001053.PE523       Location/Qualifiers
FT   CDS             595452..596486
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4525"
FT                   /product="zinc carboxypeptidase-related protein"
FT                   /note="KEGG: bxe:Bxe_B0840 zinc carboxypeptidase-related
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4525"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18898"
FT                   /db_xref="GOA:B2TGT7"
FT                   /db_xref="InterPro:IPR000834"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGT7"
FT                   /protein_id="ACD18898.1"
FT                   /translation="MQPLSFLPDSFAEYEDLRTILEQGSASFAIRTVCETTVRGRQFAV
FT                   QTASIGSTDPQAPAIGFFGGIHGLERIGSQLVLDYMRALLARLEWDELLVRQLQSIRLI
FT                   FMPIVNPGGMWAATRANPNGVDLMRNAPQNADERVPLLAGGQRVGAWLPWYRGRVGAPM
FT                   EPEASALLQVVETELATRPLSIALDCHSGYGWSDSIWFPYARTRKVMPHLPEMYVLKTM
FT                   FERAHPHHGYAFEPQSHQYLLHGDLWDFAYDRAPAPNVFLPMTLELGSWLWIKKNPRQL
FT                   FSRQGMFNPVKAHRTARVLRRHANLLDFLARAAFSSQRWLPQGNRREQLLQSAIDHWYK
FT                   PESV"
     MQPLSFLPDS FAEYEDLRTI LEQGSASFAI RTVCETTVRG RQFAVQTASI GSTDPQAPAI        60
     GFFGGIHGLE RIGSQLVLDY MRALLARLEW DELLVRQLQS IRLIFMPIVN PGGMWAATRA       120
     NPNGVDLMRN APQNADERVP LLAGGQRVGA WLPWYRGRVG APMEPEASAL LQVVETELAT       180
     RPLSIALDCH SGYGWSDSIW FPYARTRKVM PHLPEMYVLK TMFERAHPHH GYAFEPQSHQ       240
     YLLHGDLWDF AYDRAPAPNV FLPMTLELGS WLWIKKNPRQ LFSRQGMFNP VKAHRTARVL       300
     RRHANLLDFL ARAAFSSQRW LPQGNRREQL LQSAIDHWYK PESV                        344
//

If you have problems or comments...

PBIL Back to PBIL home page