(data stored in ACNUC7421 zone)

EMBL: CP001053.PE529

CP001053.PE529       Location/Qualifiers
FT   CDS             complement(605924..606232)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4531"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0846 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4531"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18904"
FT                   /db_xref="InterPro:IPR025421"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU3"
FT                   /protein_id="ACD18904.1"
FT                   /translation="MKRNLLAGLALSLLVSAPVFAQSSSGGIGRAGSYNTQPAPTTTAK
FT                   SREEVKAELVAAYRDGSLPALNRTTYPNKGLIGQTQAERIARQEGTSGDVTRVANGQ"
     MKRNLLAGLA LSLLVSAPVF AQSSSGGIGR AGSYNTQPAP TTTAKSREEV KAELVAAYRD        60
     GSLPALNRTT YPNKGLIGQT QAERIARQEG TSGDVTRVAN GQ                          102
//

If you have problems or comments...

PBIL Back to PBIL home page