(data stored in ACNUC7421 zone)

EMBL: CP001053.PE53

CP001053.PE53        Location/Qualifiers
FT   CDS             58278..58511
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4043"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bps:BPSL1298 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4043"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18428"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEA7"
FT                   /protein_id="ACD18428.1"
FT                   /translation="MSSIYYAGCKARIKNLELAWDDAEPSLKPRAGADWHKVDKAIDRA
FT                   LSALRASAPSAVECKQSLADLMAVMDRMSGKV"
     MSSIYYAGCK ARIKNLELAW DDAEPSLKPR AGADWHKVDK AIDRALSALR ASAPSAVECK        60
     QSLADLMAVM DRMSGKV                                                       77
//

If you have problems or comments...

PBIL Back to PBIL home page