(data stored in ACNUC7421 zone)

EMBL: CP001053.PE530

CP001053.PE530       Location/Qualifiers
FT   CDS             complement(606467..607471)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4532"
FT                   /product="transcriptional regulator, LysR family"
FT                   /note="PFAM: regulatory protein LysR; LysR
FT                   substrate-binding; KEGG: bxe:Bxe_B0847 transcriptional
FT                   regulator, LysR family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4532"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18905"
FT                   /db_xref="GOA:B2TGU4"
FT                   /db_xref="InterPro:IPR000847"
FT                   /db_xref="InterPro:IPR005119"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036390"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU4"
FT                   /protein_id="ACD18905.1"
FT                   /translation="MDRLQAMQVFTRVVDTNSFTRAAETLDLPRASVTTIIQNLEAFLG
FT                   TRLMHRTTRRLSLTPDGAAYYERCVRILADVEETEASFQSGNKKPHGKLRIDMPGSIGR
FT                   LLVIPSLCEFHTRYPDIDLQLGLTDRPVDLLQEGVDCVVRVGALQDSSLVARRIGLFEG
FT                   VTCAAPDYIERAGMPTSLEDLENHKAVNYFSSRTGRTLDWAFLVDGKEIEVKMKSIVSV
FT                   NDADAYVTCGLEGFGLIQPALFMVLPHLRSGQLVEVLPELKPLPMPISAVYPHSRHLSP
FT                   KVRVFVDWIAELFDRCPLLSGRGSLDATCTKRTFEERESAPMLDTPVITEWVA"
     MDRLQAMQVF TRVVDTNSFT RAAETLDLPR ASVTTIIQNL EAFLGTRLMH RTTRRLSLTP        60
     DGAAYYERCV RILADVEETE ASFQSGNKKP HGKLRIDMPG SIGRLLVIPS LCEFHTRYPD       120
     IDLQLGLTDR PVDLLQEGVD CVVRVGALQD SSLVARRIGL FEGVTCAAPD YIERAGMPTS       180
     LEDLENHKAV NYFSSRTGRT LDWAFLVDGK EIEVKMKSIV SVNDADAYVT CGLEGFGLIQ       240
     PALFMVLPHL RSGQLVEVLP ELKPLPMPIS AVYPHSRHLS PKVRVFVDWI AELFDRCPLL       300
     SGRGSLDATC TKRTFEERES APMLDTPVIT EWVA                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page