(data stored in ACNUC7421 zone)

EMBL: CP001053.PE531

CP001053.PE531       Location/Qualifiers
FT   CDS             607634..608518
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4533"
FT                   /product="Alpha/beta hydrolase fold-3 domain protein"
FT                   /note="PFAM: Alpha/beta hydrolase fold-3 domain protein;
FT                   KEGG: bxe:Bxe_B0848 putative carboxylesterase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4533"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18906"
FT                   /db_xref="GOA:B2TGU5"
FT                   /db_xref="InterPro:IPR013094"
FT                   /db_xref="InterPro:IPR029058"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU5"
FT                   /protein_id="ACD18906.1"
FT                   /translation="MRIARLDMEAFKPPYSFVPTGSSPAEADSTALEVSDVQIEGHAQD
FT                   ITLRLYRQEKKTSLPVLLYFHGGGFTKGSIDQADYASRYFAEHLPALVVSVGYSLAPQF
FT                   PFPAAPEDAHRAALWVQTRARAFGGNSKKVGVAGHDAGGQLANCLAFIARDRGDVRISA
FT                   QALFGPMLDPSLTRLGDEKRLGSDITAKECAACYRAYLPQASQRMHPYAAPLESSRLAG
FT                   LPATLIATAQNDVLHVEAEKYASSLIDAGVLTQVVRYPSVSHAALADHPPALQEAVRFF
FT                   QWRFDARASLKQK"
     MRIARLDMEA FKPPYSFVPT GSSPAEADST ALEVSDVQIE GHAQDITLRL YRQEKKTSLP        60
     VLLYFHGGGF TKGSIDQADY ASRYFAEHLP ALVVSVGYSL APQFPFPAAP EDAHRAALWV       120
     QTRARAFGGN SKKVGVAGHD AGGQLANCLA FIARDRGDVR ISAQALFGPM LDPSLTRLGD       180
     EKRLGSDITA KECAACYRAY LPQASQRMHP YAAPLESSRL AGLPATLIAT AQNDVLHVEA       240
     EKYASSLIDA GVLTQVVRYP SVSHAALADH PPALQEAVRF FQWRFDARAS LKQK             294
//

If you have problems or comments...

PBIL Back to PBIL home page