(data stored in ACNUC7421 zone)

EMBL: CP001053.PE532

CP001053.PE532       Location/Qualifiers
FT   CDS             608553..609827
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4534"
FT                   /product="efflux transporter, RND family, MFP subunit"
FT                   /note="TIGRFAM: efflux transporter, RND family, MFP
FT                   subunit; PFAM: secretion protein HlyD family protein; KEGG:
FT                   bxe:Bxe_B0849 RND efflux pump, membrane fusion protein,
FT                   CzcB subfamily"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4534"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18907"
FT                   /db_xref="GOA:B2TGU6"
FT                   /db_xref="InterPro:IPR006143"
FT                   /db_xref="InterPro:IPR032317"
FT                   /db_xref="UniProtKB/TrEMBL:B2TGU6"
FT                   /protein_id="ACD18907.1"
FT                   /translation="MTILPLSRRRVAIAALAVIVVAGLGTFGAIRVDASSPAAPTIVPE
FT                   VDVATVVQKTITDWQSYSGRLEAVEKVDVRSQVPGTIVSVNFKDGALVKKGDTLFVIDP
FT                   RPYAAEVDRAEAQLAAAQARTGYTQSDWERAQRLIADNAIAKRDYDEKQNAAREASANL
FT                   KAAQAALETARINLGYTKIVAPVSGRVSRAEITVGNVISAGATAAPLTTLVSVSPIYAS
FT                   FDADEQTYLQYLSRAKDGSKVPVELGLADETGYSRSGVIESVDNRLDTSSGTIRVRARF
FT                   DNQDGALIPGLYARVKVGGSEPHPALLIDDAAVGTDQDKKFVLVVDQNNHVAYRSIDVG
FT                   GMQGNLRVVKGGLKATDRIVVNGIQRVRPGDAVRAHMVPMTTDGDPNSAPLAQKQTPAQ
FT                   PQSQAQSQAQTQAQTQTRTKADKNS"
     MTILPLSRRR VAIAALAVIV VAGLGTFGAI RVDASSPAAP TIVPEVDVAT VVQKTITDWQ        60
     SYSGRLEAVE KVDVRSQVPG TIVSVNFKDG ALVKKGDTLF VIDPRPYAAE VDRAEAQLAA       120
     AQARTGYTQS DWERAQRLIA DNAIAKRDYD EKQNAAREAS ANLKAAQAAL ETARINLGYT       180
     KIVAPVSGRV SRAEITVGNV ISAGATAAPL TTLVSVSPIY ASFDADEQTY LQYLSRAKDG       240
     SKVPVELGLA DETGYSRSGV IESVDNRLDT SSGTIRVRAR FDNQDGALIP GLYARVKVGG       300
     SEPHPALLID DAAVGTDQDK KFVLVVDQNN HVAYRSIDVG GMQGNLRVVK GGLKATDRIV       360
     VNGIQRVRPG DAVRAHMVPM TTDGDPNSAP LAQKQTPAQP QSQAQSQAQT QAQTQTRTKA       420
     DKNS                                                                    424
//

If you have problems or comments...

PBIL Back to PBIL home page