(data stored in ACNUC7421 zone)

EMBL: CP001053.PE537

CP001053.PE537       Location/Qualifiers
FT   CDS             617368..618528
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4539"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0853 ABC methionine transporter, ATPase
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4539"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18912"
FT                   /db_xref="GOA:B2TDZ5"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR017908"
FT                   /db_xref="InterPro:IPR018449"
FT                   /db_xref="InterPro:IPR026253"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR041701"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ5"
FT                   /protein_id="ACD18912.1"
FT                   /translation="MANLFDVPQFIEDAPSLAVNPDSHATATQPAVIFDNVGKVFADAR
FT                   GVSTAALANVTLNVARGEVFGIIGRSGAGKSTLLRLVNGLEKPSSGAVRVNGVSVGELD
FT                   ERGLVALRRRIGMVFQHFNLLSAKTVRENIALPLKIAGVPKAAIDKKVDALLELVGLSA
FT                   KRDAYPASLSGGQKQRVGIARALVTDPDILLCDEATSALDPETTQAILALLRDINQRLN
FT                   LTIVLITHEMQVIREVCDTVAVIERGEVVETGAVWRVFGDPQHDATRALLRTLVHDLPI
FT                   DLAKRIKPLNDIGQADAQILLDVRFTGVDAREPDLGGLASALSVDGGHVSFVHGGIDRI
FT                   QGHAQGRLVVSAQVRADDGSTVQKQIAALLDSARRYANHVEVLGYV"
     MANLFDVPQF IEDAPSLAVN PDSHATATQP AVIFDNVGKV FADARGVSTA ALANVTLNVA        60
     RGEVFGIIGR SGAGKSTLLR LVNGLEKPSS GAVRVNGVSV GELDERGLVA LRRRIGMVFQ       120
     HFNLLSAKTV RENIALPLKI AGVPKAAIDK KVDALLELVG LSAKRDAYPA SLSGGQKQRV       180
     GIARALVTDP DILLCDEATS ALDPETTQAI LALLRDINQR LNLTIVLITH EMQVIREVCD       240
     TVAVIERGEV VETGAVWRVF GDPQHDATRA LLRTLVHDLP IDLAKRIKPL NDIGQADAQI       300
     LLDVRFTGVD AREPDLGGLA SALSVDGGHV SFVHGGIDRI QGHAQGRLVV SAQVRADDGS       360
     TVQKQIAALL DSARRYANHV EVLGYV                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page