(data stored in ACNUC7421 zone)

EMBL: CP001053.PE538

CP001053.PE538       Location/Qualifiers
FT   CDS             618521..619177
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4540"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bxe:Bxe_B0854 ABC
FT                   methionine transporter, inner membrane subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4540"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18913"
FT                   /db_xref="GOA:B2TDZ6"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ6"
FT                   /protein_id="ACD18913.1"
FT                   /translation="MSELWLSELADAIRDTIVMVGVSAFVAALIGIPLALVLVTTTRGG
FT                   IFEKRAVNSTLGALVNAFRSTPFIILLVALLPLTRLLIGTTIGVWAAIVPLSIAAIPFF
FT                   ARVAEVSLREVDRGLIEAAQAMGAQRRHIIWHVLLPEALPGILGGFTITVVAMIGSSAM
FT                   AGAVGAGGLGDLAIRYGYQRFDTTVMVTVIVLLIAIVTAVQFVGDRFVRRLAQRA"
     MSELWLSELA DAIRDTIVMV GVSAFVAALI GIPLALVLVT TTRGGIFEKR AVNSTLGALV        60
     NAFRSTPFII LLVALLPLTR LLIGTTIGVW AAIVPLSIAA IPFFARVAEV SLREVDRGLI       120
     EAAQAMGAQR RHIIWHVLLP EALPGILGGF TITVVAMIGS SAMAGAVGAG GLGDLAIRYG       180
     YQRFDTTVMV TVIVLLIAIV TAVQFVGDRF VRRLAQRA                               218
//

If you have problems or comments...

PBIL Back to PBIL home page