(data stored in ACNUC7421 zone)

EMBL: CP001053.PE540

CP001053.PE540       Location/Qualifiers
FT   CDS             620596..621924
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4542"
FT                   /product="Mn2+/Fe2+ transporter, NRAMP family"
FT                   /note="TIGRFAM: Mn2+/Fe2+ transporter, NRAMP family; PFAM:
FT                   natural resistance-associated macrophage protein; KEGG:
FT                   bxe:Bxe_B0856 manganese transport protein MntH"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4542"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18915"
FT                   /db_xref="GOA:B2TDZ8"
FT                   /db_xref="InterPro:IPR001046"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ8"
FT                   /protein_id="ACD18915.1"
FT                   /translation="MQFKLPTTATAPFCPSEVQGSVAVSPGAPFWKKILQFAGPGLLIS
FT                   IGYMDPGNWATDIEAGSRYGYSLLFVVMLSSLAAMALQCLSMRLGIATGRDLAALSRDR
FT                   YSPRVARFQWLLAELSIVACDLAEVLGGALAFHLLFKCSLTTGVLLTAFDTLIVLGLKG
FT                   KNFRDLEAIMLGLIATIGVGYIIELALVQPHWPSVAQGLIPSWQALSSREPMYLAIGIL
FT                   GATVMPHNLYLHSSIVQTRAVKRDPASIRSAIGMSRIDTIGSLVFALLINMAILILAAA
FT                   AFHATGHNQVTEIEDAYKLLAPIVGTGFAAVLFAVTLLASGQSSTFTGTVAGQVIMEGF
FT                   LKLKIPCWQRRFITRALALIPALIGVQMMGNGAVGKLLVASQVVLSLQLPFALYPLIRM
FT                   TSDRALMGEFANTLLTRFVSWTLFVVISAANLWLVVQTVGIAG"
     MQFKLPTTAT APFCPSEVQG SVAVSPGAPF WKKILQFAGP GLLISIGYMD PGNWATDIEA        60
     GSRYGYSLLF VVMLSSLAAM ALQCLSMRLG IATGRDLAAL SRDRYSPRVA RFQWLLAELS       120
     IVACDLAEVL GGALAFHLLF KCSLTTGVLL TAFDTLIVLG LKGKNFRDLE AIMLGLIATI       180
     GVGYIIELAL VQPHWPSVAQ GLIPSWQALS SREPMYLAIG ILGATVMPHN LYLHSSIVQT       240
     RAVKRDPASI RSAIGMSRID TIGSLVFALL INMAILILAA AAFHATGHNQ VTEIEDAYKL       300
     LAPIVGTGFA AVLFAVTLLA SGQSSTFTGT VAGQVIMEGF LKLKIPCWQR RFITRALALI       360
     PALIGVQMMG NGAVGKLLVA SQVVLSLQLP FALYPLIRMT SDRALMGEFA NTLLTRFVSW       420
     TLFVVISAAN LWLVVQTVGI AG                                                442
//

If you have problems or comments...

PBIL Back to PBIL home page