(data stored in ACNUC7421 zone)

EMBL: CP001053.PE543

CP001053.PE543       Location/Qualifiers
FT   CDS             complement(623501..624724)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4545"
FT                   /product="protein of unknown function DUF395 YeeE/YedE"
FT                   /note="PFAM: protein of unknown function DUF395 YeeE/YedE;
FT                   KEGG: bmu:Bmul_3826 protein of unknown function DUF395
FT                   YeeE/YedE"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4545"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18918"
FT                   /db_xref="GOA:B2TE03"
FT                   /db_xref="InterPro:IPR007272"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE03"
FT                   /protein_id="ACD18918.1"
FT                   /translation="MSDLSTSLPRVPRRFDINPKPLGAALVLIALGAVYLAQTVSGRQA
FT                   ALYLVGALLGMSLYHAAFGFTSAWRVFIADGRGAGLRAQMLMLALGVLLFFPALQAGTL
FT                   FGHPVVGLVAPAGTSVLVGAFMFGIGMQLGGGCASGTLYTVGGGSTRMIVTLAAFVIGS
FT                   VVATAHMPFWTALPSLKPLSLVTVFGAGWAIALNLAVFAAIAALTVLIERRRHGQLVNE
FT                   PPRQPHTSPWLHGPWPLFVGAIALTLLNFATLALSGRPWGVTSAFALWGAKLFATLGID
FT                   VADWPYWAAHANANSLAAPVTHDVTSVMDIGIILGAMSAAALAGRYAPVWKVPARSLIA
FT                   AVVGGLMLGYGARLAYGCNIGAYFSGIVSGSLHGWLWLAAAFAGNVLGTRLRPAFGLEV
FT                   ERVRSTGC"
     MSDLSTSLPR VPRRFDINPK PLGAALVLIA LGAVYLAQTV SGRQAALYLV GALLGMSLYH        60
     AAFGFTSAWR VFIADGRGAG LRAQMLMLAL GVLLFFPALQ AGTLFGHPVV GLVAPAGTSV       120
     LVGAFMFGIG MQLGGGCASG TLYTVGGGST RMIVTLAAFV IGSVVATAHM PFWTALPSLK       180
     PLSLVTVFGA GWAIALNLAV FAAIAALTVL IERRRHGQLV NEPPRQPHTS PWLHGPWPLF       240
     VGAIALTLLN FATLALSGRP WGVTSAFALW GAKLFATLGI DVADWPYWAA HANANSLAAP       300
     VTHDVTSVMD IGIILGAMSA AALAGRYAPV WKVPARSLIA AVVGGLMLGY GARLAYGCNI       360
     GAYFSGIVSG SLHGWLWLAA AFAGNVLGTR LRPAFGLEVE RVRSTGC                     407
//

If you have problems or comments...

PBIL Back to PBIL home page