(data stored in ACNUC7421 zone)

EMBL: CP001053.PE545

CP001053.PE545       Location/Qualifiers
FT   CDS             complement(625508..626374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4547"
FT                   /product="transcriptional regulator, XRE family"
FT                   /note="PFAM: helix-turn-helix domain protein; KEGG:
FT                   bxe:Bxe_B0860 transcriptional regulator, XRE family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4547"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18920"
FT                   /db_xref="GOA:B2TE05"
FT                   /db_xref="InterPro:IPR001387"
FT                   /db_xref="InterPro:IPR010982"
FT                   /db_xref="InterPro:IPR041413"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE05"
FT                   /protein_id="ACD18920.1"
FT                   /translation="MNTLSLAQNVPSHASAASRTVGDLLREWRQRRRMSQLLLAAEADI
FT                   STRHLSFVESGRAVPSREMVMHLAERLDVPLRARNALLVAAGYAPLFRERPLSDPQLAA
FT                   AREAVELVLKGHEPYPALAIDRHWTIIAANNALMPLLTGASPELLKPPVNALRLSLHPE
FT                   GIAASIVNWHAWREHILARLQRQIDVSGDSTLSALRDELAAYPAPPDAEPAGHDNAGVN
FT                   QIAVPLRLRTPIGVLSFFSTTTVFGTPVDVTLSELAIEAFFPADQQTAAALREFGESQR
FT                   TEAARQP"
     MNTLSLAQNV PSHASAASRT VGDLLREWRQ RRRMSQLLLA AEADISTRHL SFVESGRAVP        60
     SREMVMHLAE RLDVPLRARN ALLVAAGYAP LFRERPLSDP QLAAAREAVE LVLKGHEPYP       120
     ALAIDRHWTI IAANNALMPL LTGASPELLK PPVNALRLSL HPEGIAASIV NWHAWREHIL       180
     ARLQRQIDVS GDSTLSALRD ELAAYPAPPD AEPAGHDNAG VNQIAVPLRL RTPIGVLSFF       240
     STTTVFGTPV DVTLSELAIE AFFPADQQTA AALREFGESQ RTEAARQP                    288
//

If you have problems or comments...

PBIL Back to PBIL home page