(data stored in ACNUC7421 zone)

EMBL: CP001053.PE547

CP001053.PE547       Location/Qualifiers
FT   CDS             complement(626847..627218)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4549"
FT                   /product="addiction module killer protein"
FT                   /note="TIGRFAM: addiction module killer protein; PFAM:
FT                   protein of unknown function DUF891; KEGG: bxe:Bxe_B0862
FT                   hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4549"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18922"
FT                   /db_xref="InterPro:IPR009241"
FT                   /db_xref="InterPro:IPR014056"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE07"
FT                   /protein_id="ACD18922.1"
FT                   /translation="MVFTLARSYPQGYTAQQIGSPPVYEVNRTEQFDAWLATLADLRAR
FT                   AKILVRIRRAERGHFGDVKLLEDGVSEMRIDCGPGYRVYFAREGRMVYLLLCGGVKATQ
FT                   PADIKHAKAMWAAIRKELS"
     MVFTLARSYP QGYTAQQIGS PPVYEVNRTE QFDAWLATLA DLRARAKILV RIRRAERGHF        60
     GDVKLLEDGV SEMRIDCGPG YRVYFAREGR MVYLLLCGGV KATQPADIKH AKAMWAAIRK       120
     ELS                                                                     123
//

If you have problems or comments...

PBIL Back to PBIL home page