(data stored in ACNUC7421 zone)

EMBL: CP001053.PE548

CP001053.PE548       Location/Qualifiers
FT   CDS             627493..627861
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4550"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0863 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4550"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18923"
FT                   /db_xref="InterPro:IPR032710"
FT                   /db_xref="InterPro:IPR037401"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE08"
FT                   /protein_id="ACD18923.1"
FT                   /translation="MNAHTDLIDRYFDAWNETDGARRRELIAATWSADADYRDPLLAGA
FT                   GHAGIDAMIRAVHERFPHHTFRRTGQVDGFADRLRFSWELTTPAGDAIVKGSDFGVIDP
FT                   HGRLQAVTGFLDQVPDGV"
     MNAHTDLIDR YFDAWNETDG ARRRELIAAT WSADADYRDP LLAGAGHAGI DAMIRAVHER        60
     FPHHTFRRTG QVDGFADRLR FSWELTTPAG DAIVKGSDFG VIDPHGRLQA VTGFLDQVPD       120
     GV                                                                      122
//

If you have problems or comments...

PBIL Back to PBIL home page