(data stored in ACNUC7421 zone)

EMBL: CP001053.PE549

CP001053.PE549       Location/Qualifiers
FT   CDS             627889..628239
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4551"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0864 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4551"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18924"
FT                   /db_xref="GOA:B2TDZ9"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDZ9"
FT                   /protein_id="ACD18924.1"
FT                   /translation="MHEPAAATAPQSAITLARLSGALDSLSSVVAGFALLAGARAFMFI
FT                   ALLGWREPVLSGAGLVLLAAVGWLRWQCGEAVTVPAMRRVRPTTRSSSATCSRLAPLST
FT                   NARDVACYNRPL"
     MHEPAAATAP QSAITLARLS GALDSLSSVV AGFALLAGAR AFMFIALLGW REPVLSGAGL        60
     VLLAAVGWLR WQCGEAVTVP AMRRVRPTTR SSSATCSRLA PLSTNARDVA CYNRPL           116
//

If you have problems or comments...

PBIL Back to PBIL home page