(data stored in ACNUC7421 zone)

EMBL: CP001053.PE552

CP001053.PE552       Location/Qualifiers
FT   CDS             629651..630082
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4554"
FT                   /product="DoxX family protein"
FT                   /note="PFAM: DoxX family protein; KEGG: bxe:Bxe_B0867
FT                   conserved hypothetical membrane protein YphA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4554"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18927"
FT                   /db_xref="GOA:B2TDX3"
FT                   /db_xref="InterPro:IPR032808"
FT                   /db_xref="UniProtKB/TrEMBL:B2TDX3"
FT                   /protein_id="ACD18927.1"
FT                   /translation="MSRPVDSSVILIARIALAVLFLWGGVMKLLGYAGFVGYLHSKGVP
FT                   FVQIAAPIATAVEALGGLLLIVGFKVRPLALIMAVYTVATAVLGHDFWNVTDAALQRDM
FT                   VIHFWKNIGIAGGFLLLFVTGAGRISIDGARAPRGGLGL"
     MSRPVDSSVI LIARIALAVL FLWGGVMKLL GYAGFVGYLH SKGVPFVQIA APIATAVEAL        60
     GGLLLIVGFK VRPLALIMAV YTVATAVLGH DFWNVTDAAL QRDMVIHFWK NIGIAGGFLL       120
     LFVTGAGRIS IDGARAPRGG LGL                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page