(data stored in ACNUC7421 zone)

EMBL: CP001053.PE555

CP001053.PE555       Location/Qualifiers
FT   CDS             complement(632171..633472)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4557"
FT                   /product="major facilitator superfamily MFS_1"
FT                   /note="PFAM: General substrate transporter; major
FT                   facilitator superfamily MFS_1; KEGG: bxe:Bxe_B0871 major
FT                   facilitator superfamily (MFS)metabolite/H+ symporter"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4557"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18930"
FT                   /db_xref="GOA:B2TD16"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="InterPro:IPR036259"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD16"
FT                   /protein_id="ACD18930.1"
FT                   /translation="MQATNLGGAQAVTPRPLGRSDYKTLGLAALGGALEFYDFIIFVFF
FT                   APAIGQLFFPAAMPDWLRQVQTFGIFAAGYLARPLGGIIMAHFGDLFGRKRMFTLSVLL
FT                   MSVPTLMMGLLPTYTSIGVLAPVLLLLFRVMQGAAVGGEVPGAWVFVSEHVPQRHIGYA
FT                   CGTLTAGLTAGILLGSLIASAVNRNFAPAEISAYAWRIPFLVGGVFGMFSVYLRRWLHE
FT                   TPVFAELKQRKAIAAEVPLKAVLRDHGRAVIVSMLLTWMLSAAIVVVILMTPTLLQKQF
FT                   HIAPATALLANCVATLCLTIGCVMAGSIAGRIGAGRTIFIGGVALAVTYYVMFQQLAVD
FT                   TSALVPLYAVAGLFVGVIGAIPFVMVKAFPPVVRFSGISFSYNVAYAVFGGLTPIAVSL
FT                   MMKSNPMAAPMYVGAICILGALTTLFIKDAPQKH"
     MQATNLGGAQ AVTPRPLGRS DYKTLGLAAL GGALEFYDFI IFVFFAPAIG QLFFPAAMPD        60
     WLRQVQTFGI FAAGYLARPL GGIIMAHFGD LFGRKRMFTL SVLLMSVPTL MMGLLPTYTS       120
     IGVLAPVLLL LFRVMQGAAV GGEVPGAWVF VSEHVPQRHI GYACGTLTAG LTAGILLGSL       180
     IASAVNRNFA PAEISAYAWR IPFLVGGVFG MFSVYLRRWL HETPVFAELK QRKAIAAEVP       240
     LKAVLRDHGR AVIVSMLLTW MLSAAIVVVI LMTPTLLQKQ FHIAPATALL ANCVATLCLT       300
     IGCVMAGSIA GRIGAGRTIF IGGVALAVTY YVMFQQLAVD TSALVPLYAV AGLFVGVIGA       360
     IPFVMVKAFP PVVRFSGISF SYNVAYAVFG GLTPIAVSLM MKSNPMAAPM YVGAICILGA       420
     LTTLFIKDAP QKH                                                          433
//

If you have problems or comments...

PBIL Back to PBIL home page