(data stored in ACNUC7421 zone)

EMBL: CP001053.PE556

CP001053.PE556       Location/Qualifiers
FT   CDS             633871..634611
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4558"
FT                   /product="two component transcriptional regulator, winged
FT                   helix family"
FT                   /note="PFAM: response regulator receiver; transcriptional
FT                   regulator domain protein; KEGG: bxe:Bxe_B0872 two component
FT                   transcriptional regulator, winged helix family"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4558"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18931"
FT                   /db_xref="GOA:B2TD17"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR001867"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039420"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD17"
FT                   /protein_id="ACD18931.1"
FT                   /translation="MRIAILQRDLVMRQSIEKVLTSAGHSCSTYDDGLSMSRALARSTV
FT                   DLLVLDWQGLRLSGAEVLRAARAVGGDRLPVMFASADTAEENIVRAFVAGADDYVALPL
FT                   RAAEFRERVAALLRRAYPDRFSSASFDVGPYHFDTHRQLVMLRGQPVQLSGTQYRLASL
FT                   FFSNIGRVLSRDHIFAMVWGREFREFTRTIDSHVSRLRLLLEIEPQNEFRLQPVYKSGY
FT                   RLLHLRQGEAAVINAQIDAEKQAA"
     MRIAILQRDL VMRQSIEKVL TSAGHSCSTY DDGLSMSRAL ARSTVDLLVL DWQGLRLSGA        60
     EVLRAARAVG GDRLPVMFAS ADTAEENIVR AFVAGADDYV ALPLRAAEFR ERVAALLRRA       120
     YPDRFSSASF DVGPYHFDTH RQLVMLRGQP VQLSGTQYRL ASLFFSNIGR VLSRDHIFAM       180
     VWGREFREFT RTIDSHVSRL RLLLEIEPQN EFRLQPVYKS GYRLLHLRQG EAAVINAQID       240
     AEKQAA                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page