(data stored in ACNUC7421 zone)

EMBL: CP001053.PE56

CP001053.PE56        Location/Qualifiers
FT   CDS             complement(61098..62264)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4047"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0501 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4047"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18431"
FT                   /db_xref="InterPro:IPR008930"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB0"
FT                   /protein_id="ACD18431.1"
FT                   /translation="MTIHLDAGPLADALVMQCRSTGYAGYDPFDGLNSVLFEKLGLGCL
FT                   PFAKIAWLQLHKRSLANLRPLVGVARRRNPKGIALIILGLLERERRVGDGWSIEEAVGL
FT                   ADWLLDQRCDRKKWTHSAWGYHFDWAARAFFVPRGTPNAITTCYIARALTALGDETGER
FT                   RFTDAATDAGFFIDSLYREGDGYYAYIPGESAFVHNANLWAAAVVGETASRVGNGALMQ
FT                   RALGAARRSVAMQREDGAWRYGTRDHHSFVDGFHTGYNLEALSALQRSAGTDEFSDAIG
FT                   RGMAYYRQNFFLPDGTVKYYDNAIWPLDTHSVAQALLTLLNVGASDEDHRLADRVFKRA
FT                   LNTLYMPRERRFMYQRGRLTKNRINYLRWTQAWAFYAIGAYANSARFK"
     MTIHLDAGPL ADALVMQCRS TGYAGYDPFD GLNSVLFEKL GLGCLPFAKI AWLQLHKRSL        60
     ANLRPLVGVA RRRNPKGIAL IILGLLERER RVGDGWSIEE AVGLADWLLD QRCDRKKWTH       120
     SAWGYHFDWA ARAFFVPRGT PNAITTCYIA RALTALGDET GERRFTDAAT DAGFFIDSLY       180
     REGDGYYAYI PGESAFVHNA NLWAAAVVGE TASRVGNGAL MQRALGAARR SVAMQREDGA       240
     WRYGTRDHHS FVDGFHTGYN LEALSALQRS AGTDEFSDAI GRGMAYYRQN FFLPDGTVKY       300
     YDNAIWPLDT HSVAQALLTL LNVGASDEDH RLADRVFKRA LNTLYMPRER RFMYQRGRLT       360
     KNRINYLRWT QAWAFYAIGA YANSARFK                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page