(data stored in ACNUC7421 zone)

EMBL: CP001053.PE57

CP001053.PE57        Location/Qualifiers
FT   CDS             complement(62261..63058)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4048"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B2249 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4048"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18432"
FT                   /db_xref="InterPro:IPR025975"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB1"
FT                   /protein_id="ACD18432.1"
FT                   /translation="MNPRRYVTAVTLTFFATCSIAQTVDDPVRQLAGFQTLFATNWTHG
FT                   FDPTVDIQSPDTRDLMVVKDPLSPDRHAVKVNIRRSEDFSHVANGTPRGELVFARAAKI
FT                   ASGHEYRIEWSTLLPADFVFDDEQMQIIMQVHQTDTWVGSPPLMLQLQGGDYLFSERGG
FT                   TDTKHGHDILLPDASADRGKWVHWILRYQPDATGKRAVTDLWKNGVPVFASRGFPNAYP
FT                   HERHAYLKLGVYKPSWQNFQSRTSETGLFYGPVSISERAEGGE"
     MNPRRYVTAV TLTFFATCSI AQTVDDPVRQ LAGFQTLFAT NWTHGFDPTV DIQSPDTRDL        60
     MVVKDPLSPD RHAVKVNIRR SEDFSHVANG TPRGELVFAR AAKIASGHEY RIEWSTLLPA       120
     DFVFDDEQMQ IIMQVHQTDT WVGSPPLMLQ LQGGDYLFSE RGGTDTKHGH DILLPDASAD       180
     RGKWVHWILR YQPDATGKRA VTDLWKNGVP VFASRGFPNA YPHERHAYLK LGVYKPSWQN       240
     FQSRTSETGL FYGPVSISER AEGGE                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page