(data stored in ACNUC7421 zone)

EMBL: CP001053.PE571

CP001053.PE571       Location/Qualifiers
FT   CDS             complement(649568..650350)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4573"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0888 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4573"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18946"
FT                   /db_xref="GOA:B2TD32"
FT                   /db_xref="InterPro:IPR018764"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD32"
FT                   /protein_id="ACD18946.1"
FT                   /translation="MNLHRYPQLVDLLAAEYVLGTLRGGARRRFERYADHDTTIRKAVE
FT                   QWQRRISPMAELAEPRMPPAAVWDAIERRLGLTATREAARPRTVVETPARPSRSIFENL
FT                   AFWRGWALGVTGLAAVAVVVAVRSLLPSATPPVTAPTVAQQPETAVSHVAVLNNKDAHP
FT                   VMLVAWDEAHSTMSVHPLGKVELPAGRAMELWGIPASGHPVSLGMLPDSANGKVTAGQQ
FT                   KPENYAALAVSIEAPGGSPDHNAPSGPVVFTGKLLPVS"
     MNLHRYPQLV DLLAAEYVLG TLRGGARRRF ERYADHDTTI RKAVEQWQRR ISPMAELAEP        60
     RMPPAAVWDA IERRLGLTAT REAARPRTVV ETPARPSRSI FENLAFWRGW ALGVTGLAAV       120
     AVVVAVRSLL PSATPPVTAP TVAQQPETAV SHVAVLNNKD AHPVMLVAWD EAHSTMSVHP       180
     LGKVELPAGR AMELWGIPAS GHPVSLGMLP DSANGKVTAG QQKPENYAAL AVSIEAPGGS       240
     PDHNAPSGPV VFTGKLLPVS                                                   260
//

If you have problems or comments...

PBIL Back to PBIL home page