(data stored in ACNUC7421 zone)

EMBL: CP001053.PE572

CP001053.PE572       Location/Qualifiers
FT   CDS             complement(650350..650919)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4574"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; sigma-70
FT                   region 4 domain protein; Sigma-70 region 4 type 2; KEGG:
FT                   bxe:Bxe_B0889 sigma-24 (FecI)"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4574"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18947"
FT                   /db_xref="GOA:B2TD33"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD33"
FT                   /protein_id="ACD18947.1"
FT                   /translation="MTANPRELTPETLAELLERVAKQDGAALRELYDLAAPKLFGLALR
FT                   ILSRHEWAEEVLQDSFVNIWRFAGDYRRALSAPMTWMSAIVRNRALDHLRRVNTQETEW
FT                   SDALDDLVATGDPDPEALSAVSLQARLLAGCMQQLEPAQRQAVALAYLRDQSHSEIAEV
FT                   LSVPLGTIKSWIRRGLAKLKTCLGGE"
     MTANPRELTP ETLAELLERV AKQDGAALRE LYDLAAPKLF GLALRILSRH EWAEEVLQDS        60
     FVNIWRFAGD YRRALSAPMT WMSAIVRNRA LDHLRRVNTQ ETEWSDALDD LVATGDPDPE       120
     ALSAVSLQAR LLAGCMQQLE PAQRQAVALA YLRDQSHSEI AEVLSVPLGT IKSWIRRGLA       180
     KLKTCLGGE                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page