(data stored in ACNUC7421 zone)

EMBL: CP001053.PE577

CP001053.PE577       Location/Qualifiers
FT   CDS             complement(658042..658839)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4579"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; SMART: AAA ATPase;
FT                   KEGG: bxe:Bxe_B0892 ABC sugar transporter, ATPase subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4579"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18952"
FT                   /db_xref="GOA:B2TD38"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD38"
FT                   /protein_id="ACD18952.1"
FT                   /translation="MSTPTSASSAMPVLQARGLIKRYGNVTALDGCDFEVMPGEIMAVI
FT                   GDNGAGKSSLIKALSGATVPDEGEILLDGKPVKFRSPLDARAQGIETVYQELAVAPAMS
FT                   IAENLFLARELLKPGWRGSIFKMIDKRRMLDEATAHMKDLQIGIRSMRQAVETLSGGQR
FT                   QGVAVARSAAFARHVVILDEPTAALGVKEGNMVLELIRRVRDRGLPVILISHNMPHVFE
FT                   IADRIHIQRLGRRAALVNRADIHMSEAVAIMTGAKEADVKAIA"
     MSTPTSASSA MPVLQARGLI KRYGNVTALD GCDFEVMPGE IMAVIGDNGA GKSSLIKALS        60
     GATVPDEGEI LLDGKPVKFR SPLDARAQGI ETVYQELAVA PAMSIAENLF LARELLKPGW       120
     RGSIFKMIDK RRMLDEATAH MKDLQIGIRS MRQAVETLSG GQRQGVAVAR SAAFARHVVI       180
     LDEPTAALGV KEGNMVLELI RRVRDRGLPV ILISHNMPHV FEIADRIHIQ RLGRRAALVN       240
     RADIHMSEAV AIMTGAKEAD VKAIA                                             265
//

If you have problems or comments...

PBIL Back to PBIL home page