(data stored in ACNUC7421 zone)

EMBL: CP001053.PE578

CP001053.PE578       Location/Qualifiers
FT   CDS             complement(658859..659845)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4580"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: inner-membrane translocator; KEGG:
FT                   bxe:Bxe_B0893 ABC sugar transporter, inner membrane
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4580"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18953"
FT                   /db_xref="GOA:B2TD39"
FT                   /db_xref="InterPro:IPR001851"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD39"
FT                   /protein_id="ACD18953.1"
FT                   /translation="MSTPSAPAGHSRSFAERMPSLAEVGPLIALVLACGFFISQSSRFL
FT                   SFQNLSLILQQTMVVAVIAIGQTLIVLTGGIDLSCGMVMAFGSIIMTKFAVTLGVPPVL
FT                   AILCGVGASALFGALNGVLITRIKLPAFIVTLGTLNIAFALTQIYSNAESVSNLPDAIM
FT                   FLGNTFKLGPADVTYGTVLTLLMYLATWFVLRDTVPGRHLYALGNNPEAARLMGLSSQK
FT                   ILLTVYSLAGAIYGIAALLSVSRTGVGDPQAGQTENLDSITAVVLGGTSLFGGRGSISG
FT                   TLLGALIVGVFRNGLTLIGVSSVYQVLITGMLVILAVAADKLSHRRG"
     MSTPSAPAGH SRSFAERMPS LAEVGPLIAL VLACGFFISQ SSRFLSFQNL SLILQQTMVV        60
     AVIAIGQTLI VLTGGIDLSC GMVMAFGSII MTKFAVTLGV PPVLAILCGV GASALFGALN       120
     GVLITRIKLP AFIVTLGTLN IAFALTQIYS NAESVSNLPD AIMFLGNTFK LGPADVTYGT       180
     VLTLLMYLAT WFVLRDTVPG RHLYALGNNP EAARLMGLSS QKILLTVYSL AGAIYGIAAL       240
     LSVSRTGVGD PQAGQTENLD SITAVVLGGT SLFGGRGSIS GTLLGALIVG VFRNGLTLIG       300
     VSSVYQVLIT GMLVILAVAA DKLSHRRG                                          328
//

If you have problems or comments...

PBIL Back to PBIL home page