(data stored in ACNUC7421 zone)

EMBL: CP001053.PE579

CP001053.PE579       Location/Qualifiers
FT   CDS             complement(659938..660942)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4581"
FT                   /product="Monosaccharide-transporting ATPase"
FT                   /EC_number="3.6.3.17"
FT                   /note="PFAM: periplasmic binding protein/LacI
FT                   transcriptional regulator; KEGG: bxe:Bxe_B0894 ABC sugar
FT                   transporter, periplasmic ligand binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4581"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18954"
FT                   /db_xref="GOA:B2TD40"
FT                   /db_xref="InterPro:IPR025997"
FT                   /db_xref="InterPro:IPR028082"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD40"
FT                   /protein_id="ACD18954.1"
FT                   /translation="MNLNSRRLPVARKIVSMCVAASAVWCASASQAADQPVVGLITKTD
FT                   TNPFFVKMKQGAEAAASKDGAKLITAAGKFDGDNASQVTAIENMMTAGAKAILITPSDT
FT                   KAIVPSIKKARAAGVMVVALDTPTDPQDATDALFATDNFKAGVLIGKYAKAALNGKPAK
FT                   IATLDLAPGVSVGVLRHNGFLEGFGVKEGDPSVVCSQDTRGDQAKGQTAMENCLQKSPD
FT                   INVVYTINEPAAAGAYRALKAAGKDKSVMIVSIDGGCEGVRNVKAGAIAATSQQYPLKM
FT                   ASLGVTAGVEYAKTGKKVSGYQDTGVTLITDKPMAGIDSKDTKFGLDNCWGNK"
     MNLNSRRLPV ARKIVSMCVA ASAVWCASAS QAADQPVVGL ITKTDTNPFF VKMKQGAEAA        60
     ASKDGAKLIT AAGKFDGDNA SQVTAIENMM TAGAKAILIT PSDTKAIVPS IKKARAAGVM       120
     VVALDTPTDP QDATDALFAT DNFKAGVLIG KYAKAALNGK PAKIATLDLA PGVSVGVLRH       180
     NGFLEGFGVK EGDPSVVCSQ DTRGDQAKGQ TAMENCLQKS PDINVVYTIN EPAAAGAYRA       240
     LKAAGKDKSV MIVSIDGGCE GVRNVKAGAI AATSQQYPLK MASLGVTAGV EYAKTGKKVS       300
     GYQDTGVTLI TDKPMAGIDS KDTKFGLDNC WGNK                                   334
//

If you have problems or comments...

PBIL Back to PBIL home page