(data stored in ACNUC7421 zone)

EMBL: CP001053.PE580

CP001053.PE580       Location/Qualifiers
FT   CDS             complement(661389..662162)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4582"
FT                   /product="YcgR family protein"
FT                   /note="PFAM: type IV pilus assembly PilZ; YcgR family
FT                   protein; KEGG: bxe:Bxe_B0896 putative YcgR-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4582"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18955"
FT                   /db_xref="GOA:B2TD41"
FT                   /db_xref="InterPro:IPR009875"
FT                   /db_xref="InterPro:IPR009926"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="InterPro:IPR023787"
FT                   /db_xref="UniProtKB/Swiss-Prot:B2TD41"
FT                   /protein_id="ACD18955.1"
FT                   /translation="MIADLSLDADVAEQTQQTLGADSNFAQRHPLQIAVCLRQLVAGQD
FT                   FVTVEFGGRQIVTQILDVDSRNARFVFDAGSVADDNDALPSARQLTFRSLPGGIRTEFT
FT                   TFDATPTQFDGLPAFEAPLPTVLHYVQRREFFRVQTPVLDPYIASGRYADGGSFRLELL
FT                   DLSLGGIALKTADERFGSLERGTVLRDVALQLGGFGMLRLDLEIVAPRQVSTAKGDRRF
FT                   VIGCKFVATPGPAERTLQRVVTQLETRRQALTPRR"
     MIADLSLDAD VAEQTQQTLG ADSNFAQRHP LQIAVCLRQL VAGQDFVTVE FGGRQIVTQI        60
     LDVDSRNARF VFDAGSVADD NDALPSARQL TFRSLPGGIR TEFTTFDATP TQFDGLPAFE       120
     APLPTVLHYV QRREFFRVQT PVLDPYIASG RYADGGSFRL ELLDLSLGGI ALKTADERFG       180
     SLERGTVLRD VALQLGGFGM LRLDLEIVAP RQVSTAKGDR RFVIGCKFVA TPGPAERTLQ       240
     RVVTQLETRR QALTPRR                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page