(data stored in ACNUC7421 zone)

EMBL: CP001053.PE582

CP001053.PE582       Location/Qualifiers
FT   CDS             663638..664792
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4584"
FT                   /product="ABC transporter related"
FT                   /note="PFAM: ABC transporter related; TOBE domain protein;
FT                   Transport-associated OB domain protein; SMART: AAA ATPase;
FT                   KEGG: bmu:Bmul_3198 ABC transporter related"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4584"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18957"
FT                   /db_xref="GOA:B2TD43"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR005116"
FT                   /db_xref="InterPro:IPR008995"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR040582"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD43"
FT                   /protein_id="ACD18957.1"
FT                   /translation="MASISLRGVQKAYGEGAPVIRDVDLEIGENEFCVFLGPSGCGKST
FT                   LLRMIAGLEDLTDGDLSIGGKLMNDVPAAQRGVAMVFQSYALFPHMSVFENMAFGLKLA
FT                   KTPKDEVDRKVREAARILQLEALLERKPKALSGGQRQRVAIGRAIVREPGVFLFDEPLS
FT                   NLDATLRGQTRIEIARLHKQFAKASVVYVTHDQIEAMTLADKIVLLHAGKDTERYGSIA
FT                   QIGAPLELYHRPKSRFVAGFIGSPRMNFLPGRVASLDAQGVTITLDHTQETVRVPVNGA
FT                   GLQTSQAVTLGVRPEHLEFVDPSSVAPDDAVLTRTVSLVEQLGEHSYVHLDQPGGAALV
FT                   AKAPGNTRLAPGERASLRVPRAACHLFTEDGFAAASLESVEHYA"
     MASISLRGVQ KAYGEGAPVI RDVDLEIGEN EFCVFLGPSG CGKSTLLRMI AGLEDLTDGD        60
     LSIGGKLMND VPAAQRGVAM VFQSYALFPH MSVFENMAFG LKLAKTPKDE VDRKVREAAR       120
     ILQLEALLER KPKALSGGQR QRVAIGRAIV REPGVFLFDE PLSNLDATLR GQTRIEIARL       180
     HKQFAKASVV YVTHDQIEAM TLADKIVLLH AGKDTERYGS IAQIGAPLEL YHRPKSRFVA       240
     GFIGSPRMNF LPGRVASLDA QGVTITLDHT QETVRVPVNG AGLQTSQAVT LGVRPEHLEF       300
     VDPSSVAPDD AVLTRTVSLV EQLGEHSYVH LDQPGGAALV AKAPGNTRLA PGERASLRVP       360
     RAACHLFTED GFAAASLESV EHYA                                              384
//

If you have problems or comments...

PBIL Back to PBIL home page