(data stored in ACNUC7421 zone)

EMBL: CP001053.PE586

CP001053.PE586       Location/Qualifiers
FT   CDS             669263..670114
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4588"
FT                   /product="binding-protein-dependent transport systems inner
FT                   membrane component"
FT                   /note="PFAM: binding-protein-dependent transport systems
FT                   inner membrane component; KEGG: bvi:Bcep1808_3824
FT                   binding-protein-dependent transport systems inner membrane
FT                   component"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4588"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18961"
FT                   /db_xref="GOA:B2TD47"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD47"
FT                   /protein_id="ACD18961.1"
FT                   /translation="MFPIPIDKWKPATRRMYKLTLPVALLIWLLPMIAVLVTSVRSTEE
FT                   LSEGNYWGWPKHFAMFDNYREALTTSPMLHYFWNSVLITVPAVVGSIALAAMAGFALAI
FT                   YRFRGNSTLFATFVAGNFVPVQVLMIPVRDLSLQLGLFNTVSALILFHVSFQTGFCALF
FT                   LRNFIKQLPFELVEAARIEGANEWTVFFKIVLPLIRPALAALAILVFTFVWNDYFWALC
FT                   LTQGDDAAPITVGVAALKGQWTTAWNLVSAGSILAALPSVAMFFAMQKHFVAGLTFGAT
FT                   KG"
     MFPIPIDKWK PATRRMYKLT LPVALLIWLL PMIAVLVTSV RSTEELSEGN YWGWPKHFAM        60
     FDNYREALTT SPMLHYFWNS VLITVPAVVG SIALAAMAGF ALAIYRFRGN STLFATFVAG       120
     NFVPVQVLMI PVRDLSLQLG LFNTVSALIL FHVSFQTGFC ALFLRNFIKQ LPFELVEAAR       180
     IEGANEWTVF FKIVLPLIRP ALAALAILVF TFVWNDYFWA LCLTQGDDAA PITVGVAALK       240
     GQWTTAWNLV SAGSILAALP SVAMFFAMQK HFVAGLTFGA TKG                         283
//

If you have problems or comments...

PBIL Back to PBIL home page