(data stored in ACNUC7421 zone)

EMBL: CP001053.PE587

CP001053.PE587       Location/Qualifiers
FT   CDS             670686..673034
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4589"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A3114 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4589"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18962"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD48"
FT                   /protein_id="ACD18962.1"
FT                   /translation="MGSRPISAGFWRHLGRRAIPHSDRDKTLLGLQAAKALGNVAGFTI
FT                   DYARVPDKGASVRNFAYGARSHGAYSLVDSGAIQEIELTHFKPAPQSRYAQTSEPATGE
FT                   AHTQTPPPESTGSQTERQDKLPAHTQTQTGSSDKATQTSTSTRAGSSQTGTNGGDIAGN
FT                   RTTSSSSDEKGTQTHIQLVSEKTQAHSHGQDAETQTQRRETTDAENQAKPKVSHKGVLA
FT                   RVPRQEQSVQTHSSGPVDSSVQTEARVKNSKTQTGADVHDATVQTGSSSKTDTATQTVS
FT                   SRSSVGTRTATTSHNVQVQTAPSNARELIPQTSASLYDPRKRSPREGIQPTPRHHAGSQ
FT                   TVLPRTDQGSQANVKTQDRNTQSSLPTKEDQSSQTRVFSKDSEIQVTSPSRTRSTQTTQ
FT                   APHIGVPSFKPQRPAVPSTVKANGHWLVIDAFALASSGSNLKGDPSQMNRLTLASDSIS
FT                   SAGDVAATINLGGNEVLALTGKTLSLLGTAIGLAPSVAQLSSDIKTLIAHPENEQAKWN
FT                   VGNSAVQLFGGLLATAASFAFPPAALVPLLFPNFAEIGHAEDLRKQEAELRAQGRTAEA
FT                   DVVHGEYVKAALNATPIINWFSSFYTPAMRPAIERFELSHGNKPGSPPRGDLRPGERGD
FT                   PAVADYYGQAIQQRGQSLAAAATPYLKEVLKGTNADSITFVSRAPQMFGWPSTGQPMRM
FT                   FDRAIAITYSKKTGLCTFQFFGKDKDGVFRLPILNEGVATDDHQKNIVLMGNQLDPDKQ
FT                   KVKFDLEAYRNAPHGQMIVVDPNNYRLGA"
     MGSRPISAGF WRHLGRRAIP HSDRDKTLLG LQAAKALGNV AGFTIDYARV PDKGASVRNF        60
     AYGARSHGAY SLVDSGAIQE IELTHFKPAP QSRYAQTSEP ATGEAHTQTP PPESTGSQTE       120
     RQDKLPAHTQ TQTGSSDKAT QTSTSTRAGS SQTGTNGGDI AGNRTTSSSS DEKGTQTHIQ       180
     LVSEKTQAHS HGQDAETQTQ RRETTDAENQ AKPKVSHKGV LARVPRQEQS VQTHSSGPVD       240
     SSVQTEARVK NSKTQTGADV HDATVQTGSS SKTDTATQTV SSRSSVGTRT ATTSHNVQVQ       300
     TAPSNARELI PQTSASLYDP RKRSPREGIQ PTPRHHAGSQ TVLPRTDQGS QANVKTQDRN       360
     TQSSLPTKED QSSQTRVFSK DSEIQVTSPS RTRSTQTTQA PHIGVPSFKP QRPAVPSTVK       420
     ANGHWLVIDA FALASSGSNL KGDPSQMNRL TLASDSISSA GDVAATINLG GNEVLALTGK       480
     TLSLLGTAIG LAPSVAQLSS DIKTLIAHPE NEQAKWNVGN SAVQLFGGLL ATAASFAFPP       540
     AALVPLLFPN FAEIGHAEDL RKQEAELRAQ GRTAEADVVH GEYVKAALNA TPIINWFSSF       600
     YTPAMRPAIE RFELSHGNKP GSPPRGDLRP GERGDPAVAD YYGQAIQQRG QSLAAAATPY       660
     LKEVLKGTNA DSITFVSRAP QMFGWPSTGQ PMRMFDRAIA ITYSKKTGLC TFQFFGKDKD       720
     GVFRLPILNE GVATDDHQKN IVLMGNQLDP DKQKVKFDLE AYRNAPHGQM IVVDPNNYRL       780
     GA                                                                      782
//

If you have problems or comments...

PBIL Back to PBIL home page