(data stored in ACNUC7421 zone)

EMBL: CP001053.PE588

CP001053.PE588       Location/Qualifiers
FT   CDS             674967..675467
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4591"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_A1492 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4591"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18963"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD49"
FT                   /protein_id="ACD18963.1"
FT                   /translation="MSTVNTVLSRVLQRLAAPSTMLSIGMLLAGAMLAVDASAASFKCT
FT                   SKSSVSEKIVCKEPTLSALDDRLTAAWQRAKEATLDTAALEAARTHQWLWRQHNCTDEA
FT                   CVKSWYDRRIAELDADYVQAKQARREAFDASLAGQNLAPSAADAVRKMKGEAVANATTA
FT                   SAQ"
     MSTVNTVLSR VLQRLAAPST MLSIGMLLAG AMLAVDASAA SFKCTSKSSV SEKIVCKEPT        60
     LSALDDRLTA AWQRAKEATL DTAALEAART HQWLWRQHNC TDEACVKSWY DRRIAELDAD       120
     YVQAKQARRE AFDASLAGQN LAPSAADAVR KMKGEAVANA TTASAQ                      166
//

If you have problems or comments...

PBIL Back to PBIL home page