(data stored in ACNUC7421 zone)

EMBL: CP001053.PE589

CP001053.PE589       Location/Qualifiers
FT   CDS             complement(675513..676196)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4592"
FT                   /product="TonB family protein"
FT                   /note="TIGRFAM: TonB family protein; KEGG: bxe:Bxe_B0897
FT                   TonB protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4592"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18964"
FT                   /db_xref="GOA:B2TD50"
FT                   /db_xref="InterPro:IPR006260"
FT                   /db_xref="InterPro:IPR037682"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD50"
FT                   /protein_id="ACD18964.1"
FT                   /translation="MRLTISIDDSPTLRIVLAIVVALVVWIVFLYALGHWLDATTSQPA
FT                   PDKPLEMRVVELDPQAPVHREPAPTVKPQRPVEPRQHVAPRPAEARTPRQPTPDVQPTR
FT                   IPAPNESTASTESTARSPNSQEERQSTSQPTLPPGDTAARSIAQPLPELPDDLREQAYQ
FT                   TVATARFVIHVDGSVDVELLKPTQNPRLNQLLLEALRKWRFFPALQGGHPIESRQDVRV
FT                   HFNVS"
     MRLTISIDDS PTLRIVLAIV VALVVWIVFL YALGHWLDAT TSQPAPDKPL EMRVVELDPQ        60
     APVHREPAPT VKPQRPVEPR QHVAPRPAEA RTPRQPTPDV QPTRIPAPNE STASTESTAR       120
     SPNSQEERQS TSQPTLPPGD TAARSIAQPL PELPDDLREQ AYQTVATARF VIHVDGSVDV       180
     ELLKPTQNPR LNQLLLEALR KWRFFPALQG GHPIESRQDV RVHFNVS                     227
//

If you have problems or comments...

PBIL Back to PBIL home page