(data stored in ACNUC7421 zone)

EMBL: CP001053.PE59

CP001053.PE59        Location/Qualifiers
FT   CDS             complement(64143..65402)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4050"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0504 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4050"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18434"
FT                   /db_xref="GOA:B2TEB3"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB3"
FT                   /protein_id="ACD18434.1"
FT                   /translation="MNASIAFVPSYRESQLTGWHSVGAWAISFSYLLFCISDTLLSLEM
FT                   DGSQLVKLGAFVLLAVAILLRPRFHKLIALIVPFMLALYIAMWRAFNVNAGGEEFLRFL
FT                   APMAITVAIFAYRSKLAPVLFMFFAVVLSNDLFQCYFYLAYGLKLPLFLPVKFDSGLYL
FT                   RAQGWIGFFSEFSFINFCAFLVCRHYRPTRRSQRAAWIFLTFALLGVSFKIFATIAMYF
FT                   IVARKLTVRSFIAALSAIGLVLFALMAGLLDSLIKIAMTKISFYVVAGNSARAESYRVM
FT                   FQSLMKGNIFGEGLGSFGGPASVKYHSPLYSIYHFNWYGLGNTLTTTDTFYPHLFVELG
FT                   VLGAILWLAFMLLYGQVSKRRRVWLFLVGAFCFDNIFSMSFVSASYVFSALMLMYLFSD
FT                   NGSLISRPPSAAGKRAGAMR"
     MNASIAFVPS YRESQLTGWH SVGAWAISFS YLLFCISDTL LSLEMDGSQL VKLGAFVLLA        60
     VAILLRPRFH KLIALIVPFM LALYIAMWRA FNVNAGGEEF LRFLAPMAIT VAIFAYRSKL       120
     APVLFMFFAV VLSNDLFQCY FYLAYGLKLP LFLPVKFDSG LYLRAQGWIG FFSEFSFINF       180
     CAFLVCRHYR PTRRSQRAAW IFLTFALLGV SFKIFATIAM YFIVARKLTV RSFIAALSAI       240
     GLVLFALMAG LLDSLIKIAM TKISFYVVAG NSARAESYRV MFQSLMKGNI FGEGLGSFGG       300
     PASVKYHSPL YSIYHFNWYG LGNTLTTTDT FYPHLFVELG VLGAILWLAF MLLYGQVSKR       360
     RRVWLFLVGA FCFDNIFSMS FVSASYVFSA LMLMYLFSDN GSLISRPPSA AGKRAGAMR        419
//

If you have problems or comments...

PBIL Back to PBIL home page