(data stored in ACNUC7421 zone)

EMBL: CP001053.PE590

CP001053.PE590       Location/Qualifiers
FT   CDS             complement(676201..676599)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4593"
FT                   /product="Biopolymer transport protein ExbD/TolR"
FT                   /note="PFAM: Biopolymer transport protein ExbD/TolR; KEGG:
FT                   bxe:Bxe_B0898 biopolymer transport protein ExbD/TolR"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4593"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18965"
FT                   /db_xref="GOA:B2TD51"
FT                   /db_xref="InterPro:IPR003400"
FT                   /db_xref="UniProtKB/TrEMBL:B2TD51"
FT                   /protein_id="ACD18965.1"
FT                   /translation="MKFKRSRAARRGRIEIIPMIDVMFFLLATFMLASLAMQRLDAVKL
FT                   TLPAGRAQQLAEHEPLTISVDSRNEIFVNHLPVRPDQIEPTIKRLLQPDANVVIAADDA
FT                   AGHGAVVQAMLAARRAGAARFLIAVRPK"
     MKFKRSRAAR RGRIEIIPMI DVMFFLLATF MLASLAMQRL DAVKLTLPAG RAQQLAEHEP        60
     LTISVDSRNE IFVNHLPVRP DQIEPTIKRL LQPDANVVIA ADDAAGHGAV VQAMLAARRA       120
     GAARFLIAVR PK                                                           132
//

If you have problems or comments...

PBIL Back to PBIL home page