(data stored in ACNUC7421 zone)

EMBL: CP001053.PE6

CP001053.PE6         Location/Qualifiers
FT   CDS             6280..6783
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_3995"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0468 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_3995"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18381"
FT                   /db_xref="InterPro:IPR025512"
FT                   /db_xref="UniProtKB/TrEMBL:B2TE60"
FT                   /protein_id="ACD18381.1"
FT                   /translation="MRRTVTPVVLDVPHGSHARREVLRRTLRATLLLMFGNMVPSVFAA
FT                   AEQTPSPPGAEEYIIWPSDGTVIHGGKLWVRMGLRNMGVCPKGVVFPNTGHHHLLIDTD
FT                   LPPLDQEIPSDRNHLHFGAGETDARIELPPGKHTLQLILGDHNHVPHVPPVYSKKITIT
FT                   VLKD"
     MRRTVTPVVL DVPHGSHARR EVLRRTLRAT LLLMFGNMVP SVFAAAEQTP SPPGAEEYII        60
     WPSDGTVIHG GKLWVRMGLR NMGVCPKGVV FPNTGHHHLL IDTDLPPLDQ EIPSDRNHLH       120
     FGAGETDARI ELPPGKHTLQ LILGDHNHVP HVPPVYSKKI TITVLKD                     167
//

If you have problems or comments...

PBIL Back to PBIL home page