(data stored in ACNUC7421 zone)

EMBL: CP001053.PE63

CP001053.PE63        Location/Qualifiers
FT   CDS             complement(70416..70868)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4054"
FT                   /product="protein tyrosine phosphatase"
FT                   /note="PFAM: low molecular weight phosphotyrosine protein
FT                   phosphatase; KEGG: bxe:Bxe_B0508 protein tyrosine
FT                   phosphatase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4054"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18438"
FT                   /db_xref="GOA:B2TEB7"
FT                   /db_xref="InterPro:IPR017867"
FT                   /db_xref="InterPro:IPR023485"
FT                   /db_xref="InterPro:IPR036196"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB7"
FT                   /protein_id="ACD18438.1"
FT                   /translation="MINTVLIVCEGNLCRSPMAQGLLQRELSDIEVTSAGLSAAKGAPM
FT                   DRFAREMLADRGIDMSSHVARRLNERVCGAADLILVMELAQKQAIEKFYPTARGRVYRL
FT                   ADADHVDVPDPFGRSARIYDQAMTLIERGVLDWTRRIVDLSRGLRA"
     MINTVLIVCE GNLCRSPMAQ GLLQRELSDI EVTSAGLSAA KGAPMDRFAR EMLADRGIDM        60
     SSHVARRLNE RVCGAADLIL VMELAQKQAI EKFYPTARGR VYRLADADHV DVPDPFGRSA       120
     RIYDQAMTLI ERGVLDWTRR IVDLSRGLRA                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page