(data stored in ACNUC7421 zone)

EMBL: CP001053.PE64

CP001053.PE64        Location/Qualifiers
FT   CDS             complement(70865..72037)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4055"
FT                   /product="polysaccharide export protein"
FT                   /note="PFAM: polysaccharide export protein; KEGG:
FT                   bxe:Bxe_B0509 putative polysaccharide export, outer
FT                   membrane protein, EpsA"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4055"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18439"
FT                   /db_xref="GOA:B2TEB8"
FT                   /db_xref="InterPro:IPR003715"
FT                   /db_xref="InterPro:IPR019554"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEB8"
FT                   /protein_id="ACD18439.1"
FT                   /translation="MGHSKRTFEYGVWRQYRRRLRRALCVAFCYGLVACAAAPGMRMPT
FT                   SASLPTGNSNAQGQQADLQIPIVDINTALIKKLRDASDQTSTDQTRELSGQTGPYTLGV
FT                   GDVLQITVWDHPELAAALGNQNQNNSRPFDPAQGFVIDNGGNIQFPYAGSIHVAGLRVE
FT                   QAQQAVYAELSKIFIKPQLTVRVTSFRAKQIYVDGEVRTPGAVPVNDIPLTLYEAINRA
FT                   GGFSPAADQSRMILVRNGVSYRLNLSKMLESDQNPSGIMLKNGDLLRVVSRDDNGVFVM
FT                   GEVNKPVTALPMKSGKLTLSDALSQAGSLNTASADAAQLYVIRGSTDSQAEVFHLDAHS
FT                   PVSMILANQFELQPKDVVYVDGNGLVRFSRVLSLLLPAINAGLTTAIVTK"
     MGHSKRTFEY GVWRQYRRRL RRALCVAFCY GLVACAAAPG MRMPTSASLP TGNSNAQGQQ        60
     ADLQIPIVDI NTALIKKLRD ASDQTSTDQT RELSGQTGPY TLGVGDVLQI TVWDHPELAA       120
     ALGNQNQNNS RPFDPAQGFV IDNGGNIQFP YAGSIHVAGL RVEQAQQAVY AELSKIFIKP       180
     QLTVRVTSFR AKQIYVDGEV RTPGAVPVND IPLTLYEAIN RAGGFSPAAD QSRMILVRNG       240
     VSYRLNLSKM LESDQNPSGI MLKNGDLLRV VSRDDNGVFV MGEVNKPVTA LPMKSGKLTL       300
     SDALSQAGSL NTASADAAQL YVIRGSTDSQ AEVFHLDAHS PVSMILANQF ELQPKDVVYV       360
     DGNGLVRFSR VLSLLLPAIN AGLTTAIVTK                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page