(data stored in ACNUC7421 zone)

EMBL: CP001053.PE67

CP001053.PE67        Location/Qualifiers
FT   CDS             complement(75390..76658)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4058"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0515 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4058"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18442"
FT                   /db_xref="GOA:B2TEC1"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC1"
FT                   /protein_id="ACD18442.1"
FT                   /translation="MNSTFDTVARVHDPRPRSATPFSIGLLGIAVGLLTLWLLRDSSSF
FT                   DGATRSTVACLAIIATIAAYELFVARVYLRPSAGLASRAVRPLSIVRVELRLAALASVY
FT                   AGIGALYWLLPEYHGAFYNPFWSLLGTLAPYVLIAAPFYFAWMDRHQRETDDAYLLWAR
FT                   FLFRGERPANWRPVREMLAGWMVKAFFLPLMIVYLSTNADHLDASLTTALNAPFSLATF
FT                   RFMYDLSFAMDLMFGTVGYLCTLRILDSHVRSAEPTVLGWLVALICYQPFWSLISNQYI
FT                   HYEGSVFWDNWLISMPVVRVVWGAVIVALLLCYALTTISFGLRFSNLTNRGIITSGPYR
FT                   FTKHPAYIAKNLSYWMVTVPFIEPLGWRAAVTHCAALLAVNMLYFLRAKTEEKHLMNDS
FT                   EYREYAAWIARNGVFARLSRVFD"
     MNSTFDTVAR VHDPRPRSAT PFSIGLLGIA VGLLTLWLLR DSSSFDGATR STVACLAIIA        60
     TIAAYELFVA RVYLRPSAGL ASRAVRPLSI VRVELRLAAL ASVYAGIGAL YWLLPEYHGA       120
     FYNPFWSLLG TLAPYVLIAA PFYFAWMDRH QRETDDAYLL WARFLFRGER PANWRPVREM       180
     LAGWMVKAFF LPLMIVYLST NADHLDASLT TALNAPFSLA TFRFMYDLSF AMDLMFGTVG       240
     YLCTLRILDS HVRSAEPTVL GWLVALICYQ PFWSLISNQY IHYEGSVFWD NWLISMPVVR       300
     VVWGAVIVAL LLCYALTTIS FGLRFSNLTN RGIITSGPYR FTKHPAYIAK NLSYWMVTVP       360
     FIEPLGWRAA VTHCAALLAV NMLYFLRAKT EEKHLMNDSE YREYAAWIAR NGVFARLSRV       420
     FD                                                                      422
//

If you have problems or comments...

PBIL Back to PBIL home page