(data stored in ACNUC7421 zone)

EMBL: CP001053.PE69

CP001053.PE69        Location/Qualifiers
FT   CDS             77907..78833
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4060"
FT                   /product="hypothetical protein"
FT                   /note="KEGG: bpl:BURPS1106A_A2683 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4060"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18444"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC3"
FT                   /protein_id="ACD18444.1"
FT                   /translation="MLPMGVEEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEV
FT                   PEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPE
FT                   VPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVPEVP
FT                   EVPEVPEVPEVPEVPEVPDPDVPPKPPPPSPGLGVLSVDPHPYSASNVDVATAMAVRPA
FT                   NFFMMSPLNDYWRGHCCKLHAKCHLWRDLAFKAQVYRKNKTQEEFTPTESQFPSQRQTR
FT                   VPRACYVTRAQTVTVRNTPQSSRSTFA"
     MLPMGVEEVP EVPEVPEVPE VPEVPEVPEV PEVPEVPEVP EVPEVPEVPE VPEVPEVPEV        60
     PEVPEVPEVP EVPEVPEVPE VPEVPEVPEV PEVPEVPEVP EVPEVPEVPE VPEVPEVPEV       120
     PEVPEVPEVP EVPEVPEVPE VPEVPEVPEV PEVPEVPEVP EVPEVPEVPE VPEVPEVPEV       180
     PDPDVPPKPP PPSPGLGVLS VDPHPYSASN VDVATAMAVR PANFFMMSPL NDYWRGHCCK       240
     LHAKCHLWRD LAFKAQVYRK NKTQEEFTPT ESQFPSQRQT RVPRACYVTR AQTVTVRNTP       300
     QSSRSTFA                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page