(data stored in ACNUC7421 zone)

EMBL: CP001053.PE72

CP001053.PE72        Location/Qualifiers
FT   CDS             80806..81477
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4063"
FT                   /product="RNA polymerase, sigma-24 subunit, ECF subfamily"
FT                   /note="TIGRFAM: RNA polymerase sigma factor, sigma-70
FT                   family; PFAM: sigma-70 region 2 domain protein; Sigma-70
FT                   region 4 type 2; KEGG: bxe:Bxe_B0517
FT                   extracytoplasmic-function sigma-70 factor PvdS"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4063"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18447"
FT                   /db_xref="GOA:B2TEC6"
FT                   /db_xref="InterPro:IPR007627"
FT                   /db_xref="InterPro:IPR013249"
FT                   /db_xref="InterPro:IPR013324"
FT                   /db_xref="InterPro:IPR013325"
FT                   /db_xref="InterPro:IPR014284"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR039425"
FT                   /db_xref="UniProtKB/TrEMBL:B2TEC6"
FT                   /protein_id="ACD18447.1"
FT                   /translation="MAEVLVRREPSTAMPISVLNAAGACPPVSRRTRNHARAVDWEKGT
FT                   LLDVLIDNRPMLVNLARGFVGCASLAEDVVHDVFIKLVDFPDQDAVRQPVAYVTRMVRN
FT                   ASIDAFRRQSLENTYHADEDDGLHVPSPEPSPEAALLVRDTLRHVYNALEQLPARSRAA
FT                   FEMVRLREETLQNTARALDVSQTLVHFMVRDAEKHCADCLDACNRGVAGPAFCSGRARR
FT                   R"
     MAEVLVRREP STAMPISVLN AAGACPPVSR RTRNHARAVD WEKGTLLDVL IDNRPMLVNL        60
     ARGFVGCASL AEDVVHDVFI KLVDFPDQDA VRQPVAYVTR MVRNASIDAF RRQSLENTYH       120
     ADEDDGLHVP SPEPSPEAAL LVRDTLRHVY NALEQLPARS RAAFEMVRLR EETLQNTARA       180
     LDVSQTLVHF MVRDAEKHCA DCLDACNRGV AGPAFCSGRA RRR                         223
//

If you have problems or comments...

PBIL Back to PBIL home page