(data stored in ACNUC7421 zone)

EMBL: CP001053.PE76

CP001053.PE76        Location/Qualifiers
FT   CDS             83827..85935
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4067"
FT                   /product="transport system permease protein"
FT                   /note="PFAM: transport system permease protein; KEGG:
FT                   bxe:Bxe_B0521 iron-hydroxamate transporter permease
FT                   subunit"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4067"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18451"
FT                   /db_xref="GOA:B2TED0"
FT                   /db_xref="InterPro:IPR000522"
FT                   /db_xref="InterPro:IPR037294"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED0"
FT                   /protein_id="ACD18451.1"
FT                   /translation="MTTLAARKRLSRSTQAMDSYRAPVKSRVTTIGAALVALIVIVAVM
FT                   RLAPGFRTWLAAPTGSDAAQLAGILLFDLSVPRILAALVAGGCLAVAGTLFQSLTRNPL
FT                   ASPDLLGITGGAQLGLLAAMLVPSLAGVASVPLLFACGLGAAACVAAAAGGWRATPLRL
FT                   VLAGSVCMLLFSALTTLILAFFEQSIVGVSLWASGSLYQPGAAGLKIAASWLVLPLIAL
FT                   PFVIRPLDPLALGDDAAAAAGVRVDATRLAAMVVAVGFASVAVSVAGPLSYVGLIAPNL
FT                   LRQMRGAKASRLAALVPLSALVGGALVLVTDSAVQALDLDATLSTGVAIAFVGTPLMLA
FT                   MIRSGAAWSGALHAGQERAVARAGTRFVRAIDARPWPLTASALVLLGVVLVCAGASFGP
FT                   TTIGAQRWLAAFDHRDELARMLLDLRLPRLICALLAGALLAASGVLMQSIVRNPLAGPE
FT                   VLGVTQGAGLATLAALVMWPLANHSTLAAASLAGGGITLALTLLLNRRHRYAPLAVALT
FT                   GIVIGTLWTTLSQWLITQQSVQPARFVVWLVGGTYGRSWGEVTTLLPWCVLALPVFALL
FT                   ARPLDLLALGDDQAASLGLPIGVLRPLVLTVATLAACAAVAAVGPVGFIGLMAPHLASM
FT                   LGARAHRTRLWLAAACGALVLVVADIAARTLLAPREIPAGVLTALIGAPYLLALLIVEA
FT                   RREKRGKR"
     MTTLAARKRL SRSTQAMDSY RAPVKSRVTT IGAALVALIV IVAVMRLAPG FRTWLAAPTG        60
     SDAAQLAGIL LFDLSVPRIL AALVAGGCLA VAGTLFQSLT RNPLASPDLL GITGGAQLGL       120
     LAAMLVPSLA GVASVPLLFA CGLGAAACVA AAAGGWRATP LRLVLAGSVC MLLFSALTTL       180
     ILAFFEQSIV GVSLWASGSL YQPGAAGLKI AASWLVLPLI ALPFVIRPLD PLALGDDAAA       240
     AAGVRVDATR LAAMVVAVGF ASVAVSVAGP LSYVGLIAPN LLRQMRGAKA SRLAALVPLS       300
     ALVGGALVLV TDSAVQALDL DATLSTGVAI AFVGTPLMLA MIRSGAAWSG ALHAGQERAV       360
     ARAGTRFVRA IDARPWPLTA SALVLLGVVL VCAGASFGPT TIGAQRWLAA FDHRDELARM       420
     LLDLRLPRLI CALLAGALLA ASGVLMQSIV RNPLAGPEVL GVTQGAGLAT LAALVMWPLA       480
     NHSTLAAASL AGGGITLALT LLLNRRHRYA PLAVALTGIV IGTLWTTLSQ WLITQQSVQP       540
     ARFVVWLVGG TYGRSWGEVT TLLPWCVLAL PVFALLARPL DLLALGDDQA ASLGLPIGVL       600
     RPLVLTVATL AACAAVAAVG PVGFIGLMAP HLASMLGARA HRTRLWLAAA CGALVLVVAD       660
     IAARTLLAPR EIPAGVLTAL IGAPYLLALL IVEARREKRG KR                          702
//

If you have problems or comments...

PBIL Back to PBIL home page