(data stored in ACNUC7421 zone)

EMBL: CP001053.PE82

CP001053.PE82        Location/Qualifiers
FT   CDS             100021..105045
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4073"
FT                   /product="amino acid adenylation domain protein"
FT                   /note="TIGRFAM: amino acid adenylation domain protein;
FT                   PFAM: AMP-dependent synthetase and ligase; condensation
FT                   domain protein; phosphopantetheine-binding; KEGG:
FT                   bxe:Bxe_B0526 non-ribosomal peptide synthetase"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4073"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18457"
FT                   /db_xref="GOA:B2TED6"
FT                   /db_xref="InterPro:IPR000873"
FT                   /db_xref="InterPro:IPR001242"
FT                   /db_xref="InterPro:IPR006162"
FT                   /db_xref="InterPro:IPR009081"
FT                   /db_xref="InterPro:IPR010071"
FT                   /db_xref="InterPro:IPR020806"
FT                   /db_xref="InterPro:IPR020845"
FT                   /db_xref="InterPro:IPR023213"
FT                   /db_xref="InterPro:IPR025110"
FT                   /db_xref="InterPro:IPR036736"
FT                   /db_xref="InterPro:IPR042099"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED6"
FT                   /protein_id="ACD18457.1"
FT                   /translation="MTTAKPDLLSLASRFALLPDAQRKAFLTKLDAAGIDFRVLPIPPR
FT                   AERTASVPASFAQTRLWLHARMIDEPAAYHITERLHLDGALDANALRLSCDALIARHEA
FT                   LRTTFAESGDGVLQTVHAPSRCPWHASDVSTWPADQREARAAGIARADEAKSFDLSLGP
FT                   LMRAHLIRLDTNTHWLALTTHHIVSDGWSADVILAELASFYRAYAKSEAVSLAPLPIQY
FT                   ADFALWQRRWLDAGERERQLAFWRERLDANRDVLTLPGAAPRPAQRSARGARHRFALDA
FT                   ALVQQVKALANAQRATPFAVLLAALSALLARSSGETQIQIGVPAANRERGEVAGLVGFF
FT                   VNTLTLATPVPATQPFAGLVGATQQTLIDAQSHQDVPFEQVVEALGVVRSASHHPLFQV
FT                   MAAYGARRRLPSLAEVRMTELPSGAPFAKFDLTLSFEERDDDSIDAYFIYALDVFDADA
FT                   IERLAARFIELLSNATAAPATAVGDLQWLPEAERAQLDAWNSTAFPAEAAFRPVHQRVA
FT                   DHAIARPDARGVADINRSLTRGEVDARATRLAQRLVAAGVSAEMRVGVALSRSVDLLVG
FT                   LIAALKSGGAFVPLDPSHPRERLAQILDDAQMTHVITERGSLAALPASDRLRLWLIDEE
FT                   PQADEPPAAHVELPRVSPHQAAYVIYTSGSTGKPKGVVVDHGSFALHCAAIAERYGAGE
FT                   RDVFLLFQSVNFDGAHEGWFSQYMSGAAVAITADTLWPPAQTCRMMVREGVTMTYVPPG
FT                   CATQLAEWALSHGAPPSLRSLTVGGEATSREAFALMRRAFPNARIVNGYGPTETVITPM
FT                   LWMFYPTDDTAKLADSAYLPIGTLVGARSAHVLDARLNPLPVGVIGELYLGGEGVGVAR
FT                   GYLDRPALTAERFVPDPFGALGARLYRTGDLVKRRADGVFDFIGRVDHQVKLRGLRIEL
FT                   GEIEAQLAAHDDVREAVAIVHGKGAQAALVAYVELSAEARERSTRADAAELDAHLRHTL
FT                   PDYMVPAHIVVLDALPRNANSKVDRAALPEPQRVARAYQAPAAGLETALAQIFREVLGV
FT                   ERVGRADHFFELGGHSLAAVRVATRVAERLARDVPVRTLFEAPTLAQYAQRVLASARSE
FT                   ALANVGNDASGGASNSQPTADANGVLPLSSAQLSLWFLWRSQPDSAAYNIPVALRLRGA
FT                   LDADALREAFAQAAARHPALRVRLVERAGQLPGQRVAEPAPFDLPVVDLSDDPSATARE
FT                   SAAVALTDEDALTPFHLLDNSPLWRARLLRLAERDHVLSLVVHHIVSDGQSIDLWLDDV
FT                   RTTYVAIVRGASPSAAGLGTAANKELVLPVAAPRARLSFWRDALTDAPSHVLPSPSSGR
FT                   AASPSWSCGRLAFEFSPALVRRARSMALEVHATLPMLLHAALNVAFYRATGATDQPVGV
FT                   LASTRELTGEAARRALGLFINAVVVRTRLAKTDTPATLLAEVRDAALAAYAHADTPFAD
FT                   VVAALRARRAEAGNPLFSVMFNYLRPAGTAERDWAGLTLDEFNDVRHRVVFELELDVVE
FT                   HADGRVTGAFSYANELVDGRFVEVLTADYLGVVQQFVDAPHEQLGASAARFALQSASVA
FT                   AGAQASASSHNEASQRAEVLERVWSELFEGNTPAHHDDLFEAGASSFDVVRFVDAARSA
FT                   GHALEIADVFAAPTFAQLAARLVARGSRVVELRDGA"
     MTTAKPDLLS LASRFALLPD AQRKAFLTKL DAAGIDFRVL PIPPRAERTA SVPASFAQTR        60
     LWLHARMIDE PAAYHITERL HLDGALDANA LRLSCDALIA RHEALRTTFA ESGDGVLQTV       120
     HAPSRCPWHA SDVSTWPADQ REARAAGIAR ADEAKSFDLS LGPLMRAHLI RLDTNTHWLA       180
     LTTHHIVSDG WSADVILAEL ASFYRAYAKS EAVSLAPLPI QYADFALWQR RWLDAGERER       240
     QLAFWRERLD ANRDVLTLPG AAPRPAQRSA RGARHRFALD AALVQQVKAL ANAQRATPFA       300
     VLLAALSALL ARSSGETQIQ IGVPAANRER GEVAGLVGFF VNTLTLATPV PATQPFAGLV       360
     GATQQTLIDA QSHQDVPFEQ VVEALGVVRS ASHHPLFQVM AAYGARRRLP SLAEVRMTEL       420
     PSGAPFAKFD LTLSFEERDD DSIDAYFIYA LDVFDADAIE RLAARFIELL SNATAAPATA       480
     VGDLQWLPEA ERAQLDAWNS TAFPAEAAFR PVHQRVADHA IARPDARGVA DINRSLTRGE       540
     VDARATRLAQ RLVAAGVSAE MRVGVALSRS VDLLVGLIAA LKSGGAFVPL DPSHPRERLA       600
     QILDDAQMTH VITERGSLAA LPASDRLRLW LIDEEPQADE PPAAHVELPR VSPHQAAYVI       660
     YTSGSTGKPK GVVVDHGSFA LHCAAIAERY GAGERDVFLL FQSVNFDGAH EGWFSQYMSG       720
     AAVAITADTL WPPAQTCRMM VREGVTMTYV PPGCATQLAE WALSHGAPPS LRSLTVGGEA       780
     TSREAFALMR RAFPNARIVN GYGPTETVIT PMLWMFYPTD DTAKLADSAY LPIGTLVGAR       840
     SAHVLDARLN PLPVGVIGEL YLGGEGVGVA RGYLDRPALT AERFVPDPFG ALGARLYRTG       900
     DLVKRRADGV FDFIGRVDHQ VKLRGLRIEL GEIEAQLAAH DDVREAVAIV HGKGAQAALV       960
     AYVELSAEAR ERSTRADAAE LDAHLRHTLP DYMVPAHIVV LDALPRNANS KVDRAALPEP      1020
     QRVARAYQAP AAGLETALAQ IFREVLGVER VGRADHFFEL GGHSLAAVRV ATRVAERLAR      1080
     DVPVRTLFEA PTLAQYAQRV LASARSEALA NVGNDASGGA SNSQPTADAN GVLPLSSAQL      1140
     SLWFLWRSQP DSAAYNIPVA LRLRGALDAD ALREAFAQAA ARHPALRVRL VERAGQLPGQ      1200
     RVAEPAPFDL PVVDLSDDPS ATARESAAVA LTDEDALTPF HLLDNSPLWR ARLLRLAERD      1260
     HVLSLVVHHI VSDGQSIDLW LDDVRTTYVA IVRGASPSAA GLGTAANKEL VLPVAAPRAR      1320
     LSFWRDALTD APSHVLPSPS SGRAASPSWS CGRLAFEFSP ALVRRARSMA LEVHATLPML      1380
     LHAALNVAFY RATGATDQPV GVLASTRELT GEAARRALGL FINAVVVRTR LAKTDTPATL      1440
     LAEVRDAALA AYAHADTPFA DVVAALRARR AEAGNPLFSV MFNYLRPAGT AERDWAGLTL      1500
     DEFNDVRHRV VFELELDVVE HADGRVTGAF SYANELVDGR FVEVLTADYL GVVQQFVDAP      1560
     HEQLGASAAR FALQSASVAA GAQASASSHN EASQRAEVLE RVWSELFEGN TPAHHDDLFE      1620
     AGASSFDVVR FVDAARSAGH ALEIADVFAA PTFAQLAARL VARGSRVVEL RDGA            1674
//

If you have problems or comments...

PBIL Back to PBIL home page