(data stored in ACNUC7421 zone)

EMBL: CP001053.PE85

CP001053.PE85        Location/Qualifiers
FT   CDS             108869..109711
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="Bphyt_4076"
FT                   /product="conserved hypothetical protein"
FT                   /note="KEGG: bxe:Bxe_B0528 hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:Bphyt_4076"
FT                   /db_xref="EnsemblGenomes-Tr:ACD18460"
FT                   /db_xref="GOA:B2TED9"
FT                   /db_xref="InterPro:IPR002376"
FT                   /db_xref="InterPro:IPR036477"
FT                   /db_xref="UniProtKB/TrEMBL:B2TED9"
FT                   /protein_id="ACD18460.1"
FT                   /translation="MSKKKLVYIWSLRNAAADKAGQEIAYKSGTRYMKSVLESLVEALN
FT                   DTELGDQYSLEKVIYDDDAGSSVDREKLKEYGFAYEPGKRWLYPPNLRVQGKPVNDLLL
FT                   AIPSTYRREPLDAPGRPAGKSAFEKHLLDTLVALKADIVVLDGLLIILDELVRPGAPFY
FT                   RKIVNIHPGVTRAESPYERRGAYATLDALYGARGKKVVNWKTMETVAVEPLYLTGASFH
FT                   YVDNGIDSGEVIHDVLNTEIDKDDTILELRWNNFNRSLFPALNEGLAIMAGQTVQVEA"
     MSKKKLVYIW SLRNAAADKA GQEIAYKSGT RYMKSVLESL VEALNDTELG DQYSLEKVIY        60
     DDDAGSSVDR EKLKEYGFAY EPGKRWLYPP NLRVQGKPVN DLLLAIPSTY RREPLDAPGR       120
     PAGKSAFEKH LLDTLVALKA DIVVLDGLLI ILDELVRPGA PFYRKIVNIH PGVTRAESPY       180
     ERRGAYATLD ALYGARGKKV VNWKTMETVA VEPLYLTGAS FHYVDNGIDS GEVIHDVLNT       240
     EIDKDDTILE LRWNNFNRSL FPALNEGLAI MAGQTVQVEA                             280
//

If you have problems or comments...

PBIL Back to PBIL home page